[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mltB
DDBJ      :mltB         membrane-bound lytic transglycolase-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  375/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.2.1
:333 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   77->226 1qusA PDBj 1e-17 32.7 %
:RPS:PDB   19->333 1d0lA PDBj 2e-41 22.7 %
:RPS:SCOP  20->325 1d0kA  d.2.1.6 * 3e-57 25.6 %
:HMM:SCOP  9->335 1qusA_ d.2.1.6 * 2.2e-69 33.3 %
:HMM:PFM   197->253 PF00318 * Ribosomal_S2 5.7e-05 22.2 54/211  
:HMM:PFM   74->172 PF12090 * Spt20 7.2e-05 25.0 60/185  
:BLT:SWISS 77->226 MLTB_ECOLI 3e-17 32.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21803.1 GT:GENE mltB GT:PRODUCT membrane-bound lytic transglycolase-related protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 976379..977380 GB:FROM 976379 GB:TO 977380 GB:DIRECTION + GB:GENE mltB GB:PRODUCT membrane-bound lytic transglycolase-related protein GB:NOTE similar to Shewanella oneidensis MR-1 gb|AAN55045.1 GB:PROTEIN_ID AAZ21803.1 GB:DB_XREF GI:71062800 GB:GENE:GENE mltB LENGTH 333 SQ:AASEQ MNIIKYFIIIFFTFIHGTLYANEKEFKEWLVNFKAYALEKKISEKTFNLAMSDVVFLPDVIKYDRFQPEFYEDTKTYISKRTSKQKVSAGIKLYELNKDFINSVDNKFSVEKELLLALMGIETNFGTYVGKMDILSSLATLSYDQRRSDFFTKELITILQLIDEGKINHNILYGSWAGAFGFFQFMPSTIDNYAIDYDKNNIIELKSTKDSFASAANYINKIGWKKNQPCFIKVKLKENIPNNILNISAKKLHHKIKFKLLKKYIINEDSFNSINENLIASIITPDKDIIPDAQNLDPAYIVFDNYEKILQWNRSLRFSLAVCTLKEKFENAL GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 77->226|MLTB_ECOLI|3e-17|32.7|150/100| TM:NTM 1 TM:REGION 1->23| SEG 3->15|iikyfiiifftfi| SEG 250->266|kklhhkikfkllkkyii| BL:PDB:NREP 1 BL:PDB:REP 77->226|1qusA|1e-17|32.7|150/312| RP:PDB:NREP 1 RP:PDB:REP 19->333|1d0lA|2e-41|22.7|300/314| HM:PFM:NREP 2 HM:PFM:REP 197->253|PF00318|5.7e-05|22.2|54/211|Ribosomal_S2| HM:PFM:REP 74->172|PF12090|7.2e-05|25.0|60/185|Spt20| RP:SCP:NREP 1 RP:SCP:REP 20->325|1d0kA|3e-57|25.6|285/318|d.2.1.6| HM:SCP:REP 9->335|1qusA_|2.2e-69|33.3|312/322|d.2.1.6|1/1|Lysozyme-like| OP:NHOMO 701 OP:NHOMOORG 382 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111347775445555544344444334-4444444444114444444444453311134233333441111111111111111-----------------------------1111112222211111111111111111111111111111111211222211321112111-111111111111121-11111----111---------1-------12------------------------211322211223112333333333323233233--21221------11121111111111111-111111111111111111111111--1111111111111111121111111--222222222222---122222222212221111111-----1--122222222232244442222222222332---------11111111111111122423122221111111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------11------1--1--1--2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 93.7 SQ:SECSTR ##################cccTTTTcHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHTccccccHHHHHHHHHccHHHHHHHHHHHHHTHHHHHHHHHHHcccHHHHHHHHHHHHTTTTccccEEHHHHHHHHHHccGGHHHHHHHHHHHHHHHHHTTccTTTcEEcTTcccTTTTccHHHHHHHcccTTccccccTTcHHHHHHHHHHHHHHTTccTTccGGTTccHHHHHH###cEEEEEcccccccccTTccEEHHHHHHTTcEEccccTTccEEEEEEEEccccEEEEEEcHHHHHHHTTcccHHHHHHHHHHHHHHHHHH PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHEEEEEHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEcccccHHHHcccccccccHHHHHHccccccccccccccccccccEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHccc //