[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mmgC
DDBJ      :mmgC         acyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  500/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
a.29.3c.55.3e.6.1
:587 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   41->444 2jifB PDBj 1e-31 31.8 %
:RPS:PDB   35->584 2ddhA PDBj 7e-83 14.3 %
:RPS:SCOP  35->278 1rx0A2  e.6.1.1 * 7e-41 24.5 %
:RPS:SCOP  287->448 1is2A1  a.29.3.2 * 7e-34 13.3 %
:RPS:SCOP  452->532 1w0hA  c.55.3.5 * 4e-04 26.0 %
:HMM:SCOP  30->279 2c12A2 e.6.1.1 * 3.8e-52 35.6 %
:HMM:SCOP  285->473 1is2A1 a.29.3.2 * 6.2e-46 29.3 %
:RPS:PFM   79->157 PF02771 * Acyl-CoA_dh_N 3e-05 32.1 %
:RPS:PFM   282->454 PF00441 * Acyl-CoA_dh_1 8e-23 39.9 %
:RPS:PFM   461->536 PF08336 * P4Ha_N 1e-04 31.9 %
:HMM:PFM   281->447 PF00441 * Acyl-CoA_dh_1 3e-29 33.3 138/150  
:HMM:PFM   161->216 PF02770 * Acyl-CoA_dh_M 4.7e-14 41.2 51/52  
:HMM:PFM   75->157 PF02771 * Acyl-CoA_dh_N 1.2e-13 32.9 79/113  
:HMM:PFM   538->563 PF09628 * YvfG 0.00037 46.2 26/68  
:HMM:PFM   454->500 PF02025 * IL5 0.00011 33.3 45/113  
:HMM:PFM   16->51 PF03885 * DUF327 0.00067 22.2 36/147  
:BLT:SWISS 21->58 DPOL_HIS1V 1e-04 34.2 %
:BLT:SWISS 36->444 ACDS_CLOAB 6e-38 36.1 %
:BLT:SWISS 431->536 RBP2A_PLAF7 3e-04 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21071.1 GT:GENE mmgC GT:PRODUCT acyl-CoA dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(252166..253929) GB:FROM 252166 GB:TO 253929 GB:DIRECTION - GB:GENE mmgC GB:PRODUCT acyl-CoA dehydrogenase GB:PROTEIN_ID AAZ21071.1 GB:DB_XREF GI:71062068 GB:GENE:GENE mmgC LENGTH 587 SQ:AASEQ MPNYTAPVEDMMFLFDKLRNNKNYNDLEKYKEVNSELVKDILEEAAKINQNLILPLAKSGDENPTVLENGVVRTPPGYKEAYSKYIEDGWTSLSCDPKYGGQGMPKTVSAFFDEMLSSASLSFKLYSELSIGAYNCISHHATDEIKEKYLPKMVEGKWSGTMCLTEPVCGTDLGLLKTKAIEQSDGTFKLSGQKIFITSGDQDLTENIIHLVIARAADSPAGTKGISLFLVPKFLVNEDGSIGARNGVSTGSIESKMGIKGSATCVLNFDDATGYMIGLKNKGLNAMFTMMNLERIVVGIQGLGISEIAYQNSLSYAKERKQGKTNNTKSTNGADFIIEHADIRKSLLNMKSIIEGERALCFWLSQQTEVSLYHPDEKIKQEASDLVSLMTPVVKTMFSDMGMEITSEAMQVHGGYGYTKDQGIEQLYRDNRITPIYEGTNSIQAADLVFRKLVNKNGDIIDKYLELIKNDCSTENEKLKPFIKELKTHLEILSTFTDWIKEKVQNSKDDASAACNDYLKALGFVSIAHSWIKVLEVSFKDYEQNKDFYEDKIQTANFYFKRVLPRAESHFKTATSGSDYIMNFKFS GT:EXON 1|1-587:0| BL:SWS:NREP 3 BL:SWS:REP 21->58|DPOL_HIS1V|1e-04|34.2|38/717| BL:SWS:REP 36->444|ACDS_CLOAB|6e-38|36.1|355/379| BL:SWS:REP 431->536|RBP2A_PLAF7|3e-04|28.8|104/3130| BL:PDB:NREP 1 BL:PDB:REP 41->444|2jifB|1e-31|31.8|352/377| RP:PDB:NREP 1 RP:PDB:REP 35->584|2ddhA|7e-83|14.3|511/622| RP:PFM:NREP 3 RP:PFM:REP 79->157|PF02771|3e-05|32.1|78/113|Acyl-CoA_dh_N| RP:PFM:REP 282->454|PF00441|8e-23|39.9|148/150|Acyl-CoA_dh_1| RP:PFM:REP 461->536|PF08336|1e-04|31.9|72/133|P4Ha_N| HM:PFM:NREP 6 HM:PFM:REP 281->447|PF00441|3e-29|33.3|138/150|Acyl-CoA_dh_1| HM:PFM:REP 161->216|PF02770|4.7e-14|41.2|51/52|Acyl-CoA_dh_M| HM:PFM:REP 75->157|PF02771|1.2e-13|32.9|79/113|Acyl-CoA_dh_N| HM:PFM:REP 538->563|PF09628|0.00037|46.2|26/68|YvfG| HM:PFM:REP 454->500|PF02025|0.00011|33.3|45/113|IL5| HM:PFM:REP 16->51|PF03885|0.00067|22.2|36/147|DUF327| GO:PFM:NREP 8 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| GO:PFM GO:0004656|"GO:procollagen-proline 4-dioxygenase activity"|PF08336|IPR013547| GO:PFM GO:0005783|"GO:endoplasmic reticulum"|PF08336|IPR013547| GO:PFM GO:0016702|"GO:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen"|PF08336|IPR013547| GO:PFM GO:0055114|"GO:oxidation reduction"|PF08336|IPR013547| RP:SCP:NREP 3 RP:SCP:REP 35->278|1rx0A2|7e-41|24.5|216/231|e.6.1.1| RP:SCP:REP 287->448|1is2A1|7e-34|13.3|158/189|a.29.3.2| RP:SCP:REP 452->532|1w0hA|4e-04|26.0|77/200|c.55.3.5| HM:SCP:REP 30->279|2c12A2|3.8e-52|35.6|236/0|e.6.1.1|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 285->473|1is2A1|6.2e-46|29.3|184/189|a.29.3.2|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 4405 OP:NHOMOORG 693 OP:PATTERN 33----6655755646-232332B7555--58-----------------------------5651--- 3435G1-1---533IQGCD-DJ22IIDDDDDDKOSOFVfd4E7H-1-4----111223--96G1A9EB9CA--------2422-----11111122---31333343413--------------------------45588---83-----------------------2-------------65666---9735555545555555553455545556898911------52------------------------------------------------------------------------------------------11315444444444423222221-6-3-4-13-661478-17---11-3-41-E99B-----31CC6543EBEABAA9A9AA7977-44844A47A9C-6775657668787968686B666698B111111116----985-----------------------------1B8F816KC8F899AA85588877FBBBBB6BH7KIROM33BD8A58AAGDCEHI236----56----------B673UG9-----------755-9-4--7766C865------------1--------------22-6C28594-4444436644446464455-----1-------311--1-1223133222-2212222222222221222111-----322133333232322311122122--111111111111---4111114444-D933---------------FFEDFAD7988-GFGH8EBBDA9BC9646-------------2-----24-224444444444-------2AA8799----------1-------------------------1--11-1------ ----467-942-888988566664448554656645555545587743344689453444443--------------------------55383423334554999-885EBOABA64543596B8294Gt9-A8I5732A45C634444952D7878C7AB5C9A476BADG9E1112821-32223851233A6878 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 582 STR:RPRED 99.1 SQ:SECSTR ##ccccccccccTTTcHHHHHHHHHTTcGGGHHHcHHHHHHHHHHHHHHHTcGGGccccGGGTccEEEEHHEEccccHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHTTcccTTHHHHHTHHHHHccccHHHHHHHHHHHHTTcccEEEEcccTTccccGGGcccEEEEETTTTcccTTcEEccTTTTTccETTccEEEEEEEEEETTEEEEEEEEEEEcccEEHTTTccccTTEEEEEcccccccTTcccEEEEEccEccccccEEcTTccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTEEccccTTcccccGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHTTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHcGGGcHHHHHHHHGGGGTccccHHHHHHHHHHHHHHHHHHHHHTccccGGGGcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHTHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTcccHHHHHHH### PSIPRED cccccccHHHHHHHHHHHHccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEEcccccccccHHHcEEEEEEcccccEEEEEEEEEEcccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccccccEEEEccccccccccccEEEEEEccHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccc //