[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moaA
DDBJ      :moaA         molybdenum cofactor biosynthesis protein A
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  640/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->297 1tv7B PDBj 3e-42 35.9 %
:RPS:PDB   8->289 3cixA PDBj 1e-29 15.0 %
:RPS:SCOP  4->312 1tv7A  c.1.28.3 * 1e-69 30.4 %
:HMM:SCOP  4->279 1tv8A_ c.1.28.3 * 1.5e-67 34.1 %
:RPS:PFM   17->174 PF04055 * Radical_SAM 2e-16 34.0 %
:RPS:PFM   188->312 PF06463 * Mob_synth_C 1e-16 33.6 %
:HMM:PFM   188->313 PF06463 * Mob_synth_C 6.3e-33 34.1 126/128  
:HMM:PFM   18->178 PF04055 * Radical_SAM 1.6e-29 29.6 159/166  
:BLT:SWISS 4->330 MOAA_SHIDS 3e-91 47.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21581.1 GT:GENE moaA GT:PRODUCT molybdenum cofactor biosynthesis protein A GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(740065..741057) GB:FROM 740065 GB:TO 741057 GB:DIRECTION - GB:GENE moaA GB:PRODUCT molybdenum cofactor biosynthesis protein A GB:PROTEIN_ID AAZ21581.1 GB:DB_XREF GI:71062578 GB:GENE:GENE moaA LENGTH 330 SQ:AASEQ MKLLSDTFGRKFPYIRLSITDVCNYKCSYCLPQGYKKTPGDTRSFMSAQEISRLTKALSELGVCKIRLTGGEPTVRKDFFDILKDMKQNSNIPKVTMTTNGYRLDKIAEQLFEAGLDGINISIDSLNRETFKKLTGHDRLNEILEGIKILQKLDFKNIKINAVLLKGINDTHEEFKKFGNFIKDNNIDFRFIELMQTGDNLEYFKKNHVSSKLFKDYLEKNNWIPQTYGKDAGPSLNFIHPNFKGKFGLIAPYTKDFCQTCNRLRVTSRGDLRLCLFGNTGISIRHLLQDDAQKDELVDLIIKQLHLKKESHYLELGDTGITPNLSSTGG GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 4->330|MOAA_SHIDS|3e-91|47.4|325/329| BL:PDB:NREP 1 BL:PDB:REP 4->297|1tv7B|3e-42|35.9|281/326| RP:PDB:NREP 1 RP:PDB:REP 8->289|3cixA|1e-29|15.0|273/345| RP:PFM:NREP 2 RP:PFM:REP 17->174|PF04055|2e-16|34.0|156/164|Radical_SAM| RP:PFM:REP 188->312|PF06463|1e-16|33.6|125/128|Mob_synth_C| HM:PFM:NREP 2 HM:PFM:REP 188->313|PF06463|6.3e-33|34.1|126/128|Mob_synth_C| HM:PFM:REP 18->178|PF04055|1.6e-29|29.6|159/166|Radical_SAM| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF06463|IPR010505| GO:PFM GO:0019008|"GO:molybdopterin synthase complex"|PF06463|IPR010505| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF06463|IPR010505| RP:SCP:NREP 1 RP:SCP:REP 4->312|1tv7A|1e-69|30.4|306/327|c.1.28.3| HM:SCP:REP 4->279|1tv8A_|1.5e-67|34.1|273/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 1199 OP:NHOMOORG 854 OP:PATTERN 22142211222222231322222111122111313212111111212131354414222121112--- 211111111111-12--44-42--223433322111332211131112111-1111-1--11212131111-------1121111111-------------1-11111-1---------------1111211111111111---111111111111111111111111111------------11-112--1-12232332313333331111113322211--111111111111111111111111111111------1---11-------------------2-11----------------------------------3213511111211212111-1111-2111-111332121311121-31112112111-----111111111311111111111111-11211212111-1112111211112122111121221111111111111111113-----------------------------11111-111122222221222122112212212122121-11111-111111111111121132----------113-2223122112111-4142513222222112221112111111-1111111122111111112111-1-12222212222222222222----111------21111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----1---1121111111111111111111111-11113122222221232222111---------1111111111111111111111111----111311-----------------------------------------12---1---11- ----111-----12111111111111111111111111-111111111112111-1111111-----------1---------------1211111----2-1111-121313111211-111113131AH4-321111121111-1-1-1111131111-1112212113232111119111112234-111121211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 89.7 SQ:SECSTR #EEEEcTHccEEEEEEEEEEcccccccTTcEETTcTTccccccccccHHHHHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHTHHTTccEEEEEcccccHHHHHHHHHTTccEEEcccccccHHHHHHHcTTccHHHHHHHHHHHHTTcETEEEccEEccTTccHcHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHTccccccHHHHHHcTTHHHHHHTTTccEEccccccTTTGGGccccccTcTTTTccTTcHHHHHHHGcccHHHH################################# DISOP:02AL 315-321| PSIPRED cccccHHccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEEccccHHHHHcccccHHHHHHHHHHccccccccccccccEEEEEEccccEEEEEEEcccccccccccEEEEEEccEEEEEEcccccccHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccc //