[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moaB
DDBJ      :moaB         molybdopterin biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  309/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.57.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->165 1r2kB PDBj 2e-23 38.5 %
:RPS:PDB   3->139 1eavA PDBj 2e-10 22.1 %
:RPS:SCOP  3->162 1mkzA  c.57.1.1 * 4e-29 35.0 %
:HMM:SCOP  1->155 2g2cA1 c.57.1.1 * 6.1e-41 36.6 %
:RPS:PFM   63->131 PF00994 * MoCF_biosynth 8e-07 42.9 %
:HMM:PFM   8->147 PF00994 * MoCF_biosynth 1.2e-33 37.6 133/144  
:BLT:SWISS 5->165 MOAB_ECOLI 7e-26 38.0 %
:PROS 64->77|PS01078|MOCF_BIOSYNTHESIS_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21572.1 GT:GENE moaB GT:PRODUCT molybdopterin biosynthesis protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 734324..734824 GB:FROM 734324 GB:TO 734824 GB:DIRECTION + GB:GENE moaB GB:PRODUCT molybdopterin biosynthesis protein GB:PROTEIN_ID AAZ21572.1 GB:DB_XREF GI:71062569 GB:GENE:GENE moaB LENGTH 166 SQ:AASEQ MIVNIALLTVTDTRTFENDKSGAILVKKIEEAKHKLIDRKICKDNKDDIIKILKDWINQSEIDVVITTGGTGLTGRDITPEAVNEIADKHIPGFGEVFRTISLKTVGTSTIQSRACAVLANGKYVFALPGSSGGVTDAWDGILKHQLDINHKPCNFVELFPRLKEK GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 5->165|MOAB_ECOLI|7e-26|38.0|158/170| PROS 64->77|PS01078|MOCF_BIOSYNTHESIS_1|PDOC00828| SEG 37->55|idrkickdnkddiikilkd| SEG 67->75|ttggtgltg| BL:PDB:NREP 1 BL:PDB:REP 5->165|1r2kB|2e-23|38.5|156/166| RP:PDB:NREP 1 RP:PDB:REP 3->139|1eavA|2e-10|22.1|131/154| RP:PFM:NREP 1 RP:PFM:REP 63->131|PF00994|8e-07|42.9|63/143|MoCF_biosynth| HM:PFM:NREP 1 HM:PFM:REP 8->147|PF00994|1.2e-33|37.6|133/144|MoCF_biosynth| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 1 RP:SCP:REP 3->162|1mkzA|4e-29|35.0|160/170|c.57.1.1| HM:SCP:REP 1->155|2g2cA1|6.1e-41|36.6|153/0|c.57.1.1|1/1|Molybdenum cofactor biosynthesis proteins| OP:NHOMO 350 OP:NHOMOORG 332 OP:PATTERN ----------------111111-1--------1-1111-----11-1-11111----11----1---- --------------------------------------------------------------------------------111-1----------------------1----------------------------11111---112211111----111111----1111------------111-------11111111111111111111-1111-111--1----1-1-11111111111111111111-----------11-1------------------------------------------------------------1111111-1-------------------11-----------------12112-------1111111-111------------11111111111-1111111111111-12111-----11111111111111-1-11-----------------------------11111-11111---------------------------------------11--------------------------1-1-----------1-1------11111----------------------------111112111-1-11------1----1-11-11----111------1111-111111111111-111111111111111111111111---111111111111111111111111-----------------1---------11111----------------------1111122222221122221111--------------1111111111--11112111------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 96.4 SQ:SECSTR ##EEEEEEEEcHHHHTccccHHHHHHHHTTTTcEEEEEEEEEcccHHHHHHHHHHHHHTccccEEEEEccccccTTccHHHHHHTTccEEcHHHHHHHHHHTTcGHTEEGGGccccEEEEETTEEEEEcccHHHHHHHHHHHHTHHHcTTcccccc###GGGccc# DISOP:02AL 164-166| PSIPRED cEEEEEEEEEcccccHHccccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHcccccHHHHHHHHccccccccEEEEcccEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEccccccc //