[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moaC
DDBJ      :moaC         molybdopterin cofactor synthesis protein
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  627/915 : Eukaryota  120/199 : Viruses  0/175   --->[See Alignment]
d.58.21
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->167 2ideI PDBj 2e-28 39.7 %
:RPS:PDB   26->170 2eeyA PDBj 1e-44 31.7 %
:RPS:SCOP  27->154 1ekrA  d.58.21.1 * 6e-14 34.4 %
:HMM:SCOP  23->168 1ekrA_ d.58.21.1 * 1.5e-47 47.6 %
:RPS:PFM   27->162 PF01967 * MoaC 4e-30 42.6 %
:HMM:PFM   27->162 PF01967 * MoaC 4.9e-47 44.9 136/136  
:BLT:SWISS 21->168 MOAC_CAMJE 3e-33 45.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21580.1 GT:GENE moaC GT:PRODUCT molybdopterin cofactor synthesis protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(739519..740064) GB:FROM 739519 GB:TO 740064 GB:DIRECTION - GB:GENE moaC GB:PRODUCT molybdopterin cofactor synthesis protein GB:PROTEIN_ID AAZ21580.1 GB:DB_XREF GI:71062577 GB:GENE:GENE moaC LENGTH 181 SQ:AASEQ MANLKVINEEKLKDWAKEIFKKNSFNMIDVSSKKETFRRALASGKIYVGKEVFNLIRNKEMPKGDPITLAEVSAILGVKKTSELIPLCHPLPIDHTATKIIMHEDDSSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLRIDNVKLLIKEGGKSGLWINPDGLPEFLKDIF GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 21->168|MOAC_CAMJE|3e-33|45.3|148/157| BL:PDB:NREP 1 BL:PDB:REP 27->167|2ideI|2e-28|39.7|141/147| RP:PDB:NREP 1 RP:PDB:REP 26->170|2eeyA|1e-44|31.7|145/160| RP:PFM:NREP 1 RP:PFM:REP 27->162|PF01967|4e-30|42.6|136/136|MoaC| HM:PFM:NREP 1 HM:PFM:REP 27->162|PF01967|4.9e-47|44.9|136/136|MoaC| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF01967|IPR002820| RP:SCP:NREP 1 RP:SCP:REP 27->154|1ekrA|6e-14|34.4|128/143|d.58.21.1| HM:SCP:REP 23->168|1ekrA_|1.5e-47|47.6|143/0|d.58.21.1|1/1|Molybdenum cofactor biosynthesis protein C, MoaC| OP:NHOMO 876 OP:NHOMOORG 804 OP:PATTERN --1111111111111111-----1111111111-1111111111111111111111111111111--- 111111111111-111133-31--113333311111111111111-12111-1111-1--1-111111111-------1111111111-------------1-111111----------------1111111111111111---111111111111111111111111111------------11111---1-11111111111111111111111111111--111111111111111111111111111111------1---11---------------------------------------------------------11112111111111111---1111--111-111111111-11111-1---1111111-----111111111111111111111111-11111111111-1111111111111112111111111111111111111111111-----------------------------11111-111111111111----11111111111111111-111111121111111111111111----------111-1111111111111-2121111111111111111111111111-1111111111-11111112111-1-11111111111111111111----111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------1111111111111111111111111111111111111221111111111---------1111111111111111111111111----111111-----------------------------------------11---1---11- ----11------1211-1-11-111-1------111-1-1111---11111111-1111--------------1---------------121-111----1-111--12-21221-11111111111314A2-211-1-12---1-111-11-1111-2--113121211221111111G1111111-2111111-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 80.1 SQ:SECSTR #########################ccccccccccEEEEEEEEEEEEEcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcTTcccccccEEEEEEEEEcccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHTTTccccEEcccEEEEEEccTTccEEcc########### DISOP:02AL 1-3| PSIPRED ccccEEccccccccccccccccccEEEEEccccccEEEEEEEEEEEEEcHHHHHHHHccccccccHHHHHHHHHHHHHHHcHHHccccccccccEEEEEEEEcccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEccEEEEEEccccccccccccccHHHHHHcc //