[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moaD
DDBJ      :moaD         probable molybdopterin biosynthesis protein moaD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->52 1wgkA  d.15.3.3 * 4e-04 13.7 %
:HMM:SCOP  1->87 1vjkA_ d.15.3.1 * 3e-10 21.8 %
:HMM:PFM   7->89 PF02597 * ThiS 3.2e-06 19.2 73/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21579.1 GT:GENE moaD GT:PRODUCT probable molybdopterin biosynthesis protein moaD GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(739247..739516) GB:FROM 739247 GB:TO 739516 GB:DIRECTION - GB:GENE moaD GB:PRODUCT probable molybdopterin biosynthesis protein moaD GB:PROTEIN_ID AAZ21579.1 GB:DB_XREF GI:71062576 GB:GENE:GENE moaD LENGTH 89 SQ:AASEQ MKIKLELFGASRDFSNKDYLEFDLKEKIEIKDLRREIIDYLDINFKGNEDFIKIVKSSAFCSEDNNIVNDNFKITKDQKIGIIPPIGGG GT:EXON 1|1-89:0| SEG 80->88|igiippigg| HM:PFM:NREP 1 HM:PFM:REP 7->89|PF02597|3.2e-06|19.2|73/78|ThiS| RP:SCP:NREP 1 RP:SCP:REP 1->52|1wgkA|4e-04|13.7|51/114|d.15.3.3| HM:SCP:REP 1->87|1vjkA_|3e-10|21.8|87/0|d.15.3.1|1/1|MoaD/ThiS| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-89| PSIPRED cEEEEEEEEcccccccccEEEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEcccEEEEcccccEEccccccc //