[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moaE
DDBJ      :moaE         molybdopterin biosynthesis protein E chain
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  224/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
d.41.5
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->142 2omdB PDBj 5e-21 40.2 %
:RPS:SCOP  7->139 1fm0E  d.41.5.1 * 1e-13 24.4 %
:HMM:SCOP  3->142 1fm0E_ d.41.5.1 * 6.2e-35 29.9 %
:RPS:PFM   9->124 PF02391 * MoaE 1e-12 29.8 %
:HMM:PFM   7->123 PF02391 * MoaE 2.9e-29 35.7 115/117  
:BLT:SWISS 18->147 MOAE_PYRAB 3e-22 38.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21578.1 GT:GENE moaE GT:PRODUCT molybdopterin biosynthesis protein E chain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(738804..739247) GB:FROM 738804 GB:TO 739247 GB:DIRECTION - GB:GENE moaE GB:PRODUCT molybdopterin biosynthesis protein E chain GB:PROTEIN_ID AAZ21578.1 GB:DB_XREF GI:71062575 GB:GENE:GENE moaE LENGTH 147 SQ:AASEQ MLHAKIIDIEKNKIKTSEAEAFIKSSTYGASIIFTGNVRNINENKEVIGIAYDSHDELVLKSFEEIYKETTEKLKIIDKAVFIEHIKGYVGLGETSIIIAVACKHRDEAYVLSRYIIEEIKKRSPIWKKEHYKNDESEWLKGNPIKK GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 18->147|MOAE_PYRAB|3e-22|38.9|126/148| BL:PDB:NREP 1 BL:PDB:REP 29->142|2omdB|5e-21|40.2|112/145| RP:PFM:NREP 1 RP:PFM:REP 9->124|PF02391|1e-12|29.8|114/117|MoaE| HM:PFM:NREP 1 HM:PFM:REP 7->123|PF02391|2.9e-29|35.7|115/117|MoaE| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF02391|IPR003448| RP:SCP:NREP 1 RP:SCP:REP 7->139|1fm0E|1e-13|24.4|123/142|d.41.5.1| HM:SCP:REP 3->142|1fm0E_|6.2e-35|29.9|137/149|d.41.5.1|1/1|Molybdopterin synthase subunit MoaE| OP:NHOMO 389 OP:NHOMOORG 338 OP:PATTERN ---1------------1------1--------------11111111111-----1111111111---- 111-1------1--1--11-1-----22222-----1------1-----11-1111-1----11---1111------------1111----------------11111----------------------1---11111-1---1111111111111------11111111------------11111---1-13333332313333331111113322111--1111111111111111111111111111--------1---11-1-----------------------------------------------------------------------------------1------------------1--1-1------------------------------------------------------------------------1-----------1---------------------------------1-----------------------------------------1---------------11-11--------------------------------------11-111---------------------------11111-------1-----1-----------------1-1-------1------------------------------------------1---------------------------------------------------1--1111111111111111111111-1111-------121------111---------1111111111111111111111111------1-11--------------------------------------------------11- ----11-------11--111-11211-11----1111111111-11--111-11--1-1111-----------1---------------111-1-1------111--1----111111------22----------1-----11-------1-1-111-1111211-112-1111-11-71--11-1-111111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 94.6 SQ:SECSTR ##ccccEEEEccccccHHHHHHHccTTccEEEEEEEcccccGGGTcEEEEEEEccHHHHHHHHHHHHHHHHHHHcc#TcEEEEEEEcEEEETTcccEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcTTGGGTccc##### DISOP:02AL 1-2, 145-147| PSIPRED cccEEEEEEEcccccHHHHHHHHHcccccEEEEEEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEccccccc //