[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mobA
DDBJ      :mobA         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  209/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->193 1h4dA PDBj 4e-15 31.6 %
:RPS:PDB   4->190 2e8bA PDBj 1e-23 27.3 %
:RPS:SCOP  4->197 1e5kA  c.68.1.8 * 2e-16 25.9 %
:HMM:SCOP  1->197 1e5kA_ c.68.1.8 * 6.8e-27 23.7 %
:RPS:PFM   8->202 PF01128 * IspD 1e-04 32.2 %
:HMM:PFM   7->71 PF02348 * CTP_transf_3 1.6e-07 25.8 62/217  
:HMM:PFM   86->183 PF04192 * Utp21 0.00038 25.0 96/235  
:BLT:SWISS 8->51 ISPD_AQUAE 6e-04 38.6 %
:BLT:SWISS 22->203 MOBA_NITHX 2e-22 29.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21503.1 GT:GENE mobA GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 668645..669265 GB:FROM 668645 GB:TO 669265 GB:DIRECTION + GB:GENE mobA GB:PRODUCT hypothetical protein GB:NOTE similar to COG0746: Molybdopterin-guanine dinucleotide biosynthesis protein A GB:PROTEIN_ID AAZ21503.1 GB:DB_XREF GI:71062500 GB:GENE:GENE mobA LENGTH 206 SQ:AASEQ MNDNNILAVVLAGGKSKRFGQDKNCVKLGSKTLLEHVLFKISNKFEEILIVSSNPLKIEEAKNTTIIPDCFNDLGPLAGVLSSMKWIKENKKSYKWIATFPSDTPFFDPIIIEEYKARIEQSKSSLYFVKSNEKRHNIFGLWSIDLMEKLEEDLVINNYRKVEEWANKVGVSTIDIKIKNYDPFFNINTKEDLDVAQTILNLDKND GT:EXON 1|1-206:0| BL:SWS:NREP 2 BL:SWS:REP 8->51|ISPD_AQUAE|6e-04|38.6|44/213| BL:SWS:REP 22->203|MOBA_NITHX|2e-22|29.3|181/209| BL:PDB:NREP 1 BL:PDB:REP 6->193|1h4dA|4e-15|31.6|177/188| RP:PDB:NREP 1 RP:PDB:REP 4->190|2e8bA|1e-23|27.3|176/185| RP:PFM:NREP 1 RP:PFM:REP 8->202|PF01128|1e-04|32.2|180/222|IspD| HM:PFM:NREP 2 HM:PFM:REP 7->71|PF02348|1.6e-07|25.8|62/217|CTP_transf_3| HM:PFM:REP 86->183|PF04192|0.00038|25.0|96/235|Utp21| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01128|IPR001228| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF01128|IPR001228| RP:SCP:NREP 1 RP:SCP:REP 4->197|1e5kA|2e-16|25.9|185/188|c.68.1.8| HM:SCP:REP 1->197|1e5kA_|6.8e-27|23.7|186/0|c.68.1.8|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 218 OP:NHOMOORG 216 OP:PATTERN --------------------------------------1---------------1-11-11------- -----------------------------------------------------------------------------------11-11----------------------------------------------1------111--------------------------1-----------------------11111111-111111-1----111-----------------------------------1----------------------------------------------------------------------12-1----------------1-----1------------111-------1-----------11111111-111111-11111111---1--1--11--111111111121111--111----11111111111----11-------------------------------1------111--------------------------1-1-----------------1--111------------1----------------------------------11--1--------1-1------------1---1----------1---------1-------1-1------1111-1-1111111111-111111111111111111111111-1-1111111111111111-1111111--1111-1111111---------------------111-1111-11------------1-------------------------------111-1-11----------------11------------------------------------------------------1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 96.6 SQ:SECSTR #cccccEEEEEEEcccccccTTHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEcccGGGGGGTccEEEcccccccHHHHHHHHHHHccccHHTTcEEEEEETTcTTccHHHHHHHHHTccccEEEEEccETTEcEEEEEEEEEGGGHHHHHHHHHTTccccHHHHHHHHccEEEEccGGGGGGGccccccHHHHHHHHHc###### DISOP:02AL 1-3, 203-206| PSIPRED cccccEEEEEEcccccccccccccEEEEccEEHHHHHHHHHHHHccEEEEEcccHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEccccccccEEEEEcHHHHHHHHHHHHccccHHHHHHHHHcccEEEEEEccccHHHcccccHHHHHHHHHHHHHHccc //