[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moeA
DDBJ      :moeA         molybdopterin biosynthesis protein moeA
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  608/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
b.103.1b.85.6c.57.1
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->332 1t3eB PDBj 5e-33 32.0 %
:RPS:PDB   78->316 3dqqB PDBj 1e-21 10.4 %
:RPS:SCOP  21->178 1uz5A2  b.103.1.1 * 5e-37 30.3 %
:RPS:SCOP  179->328 1fc5A3  c.57.1.2 * 5e-32 29.7 %
:RPS:SCOP  348->402 1fc5A1  b.85.6.1 * 3e-05 21.8 %
:HMM:SCOP  1->178 1uz5A2 b.103.1.1 * 7e-40 28.6 %
:HMM:SCOP  177->330 1wu2A3 c.57.1.2 * 2.6e-24 27.7 %
:HMM:SCOP  329->406 1g8lA1 b.85.6.1 * 2.5e-05 20.5 %
:RPS:PFM   21->169 PF03453 * MoeA_N 9e-17 27.3 %
:RPS:PFM   185->319 PF00994 * MoCF_biosynth 2e-11 30.7 %
:HMM:PFM   1->169 PF03453 * MoeA_N 1.5e-39 27.0 163/163  
:HMM:PFM   184->321 PF00994 * MoCF_biosynth 7.8e-24 23.8 130/144  
:HMM:PFM   334->392 PF03454 * MoeA_C 3.8e-08 24.1 58/73  
:BLT:SWISS 21->401 MOEA_HAEIN 3e-43 31.4 %
:PROS 256->290|PS01079|MOCF_BIOSYNTHESIS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21504.1 GT:GENE moeA GT:PRODUCT molybdopterin biosynthesis protein moeA GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 669258..670505 GB:FROM 669258 GB:TO 670505 GB:DIRECTION + GB:GENE moeA GB:PRODUCT molybdopterin biosynthesis protein moeA GB:PROTEIN_ID AAZ21504.1 GB:DB_XREF GI:71062501 GB:GENE:GENE moeA LENGTH 415 SQ:AASEQ MIDYKKAKNILIKSKINIKDEVINTSKSLNRINVQDIYCPVNYPAGTNAAFDGFAINSKDTSTINKKNPKEFKILKSISAGDNPKLNKVKKFQAVEVMTGALIPKYFDTIIPIEKIVFTNNKKSIVINEKIKTNQHIRHAGSDYKKNELVINKGTIIQPSHILAFKTLGIKSIKVKKKLNILFFSTGNEISNNIDIADWKVRNSNSHYIKSLSNNFLFNYIEGGILRDKDEQFFKKQIDKNLRSKIDIIVTSGAVSAGKHDFIPSVVKKFNLSNFFKGVAIRPGKPILFAKFKGSEKAFFGLPGNPISSSACFRFFVYPYILNILGVKEEKPFKAKLKNSFFKKKNFTRFIKARLTTTHNGNLEIKVLKGQESFRIKSFVESNIWGLFKHGQSNFKKSELIDCYSPIGSNINIFK GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 21->401|MOEA_HAEIN|3e-43|31.4|369/404| PROS 256->290|PS01079|MOCF_BIOSYNTHESIS_2|PDOC00828| SEG 5->19|kkaknilikskinik| SEG 333->347|fkaklknsffkkknf| BL:PDB:NREP 1 BL:PDB:REP 21->332|1t3eB|5e-33|32.0|294/405| RP:PDB:NREP 1 RP:PDB:REP 78->316|3dqqB|1e-21|10.4|230/412| RP:PFM:NREP 2 RP:PFM:REP 21->169|PF03453|9e-17|27.3|143/163|MoeA_N| RP:PFM:REP 185->319|PF00994|2e-11|30.7|127/143|MoCF_biosynth| HM:PFM:NREP 3 HM:PFM:REP 1->169|PF03453|1.5e-39|27.0|163/163|MoeA_N| HM:PFM:REP 184->321|PF00994|7.8e-24|23.8|130/144|MoCF_biosynth| HM:PFM:REP 334->392|PF03454|3.8e-08|24.1|58/73|MoeA_C| GO:PFM:NREP 2 GO:PFM GO:0032324|"GO:molybdopterin cofactor biosynthetic process"|PF03453|IPR005110| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 3 RP:SCP:REP 21->178|1uz5A2|5e-37|30.3|155/176|b.103.1.1| RP:SCP:REP 179->328|1fc5A3|5e-32|29.7|145/149|c.57.1.2| RP:SCP:REP 348->402|1fc5A1|3e-05|21.8|55/82|b.85.6.1| HM:SCP:REP 1->178|1uz5A2|7e-40|28.6|175/176|b.103.1.1|1/1|MoeA N-terminal region -like| HM:SCP:REP 177->330|1wu2A3|2.6e-24|27.7|141/0|c.57.1.2|1/1|Molybdenum cofactor biosynthesis proteins| HM:SCP:REP 329->406|1g8lA1|2.5e-05|20.5|78/0|b.85.6.1|1/1|MoeA C-terminal domain-like| OP:NHOMO 1256 OP:NHOMOORG 814 OP:PATTERN --2231222222222223333333211222122-2223433332422521232122222222222--- 111112222221-1-1111-11--11111111111111111--1-1-11---1111-1----121221111--------113111111-------------1-11111-----------------1111111111121131---1211111111-1111111-11111111-------------1111-----13333332313333331111113321111--111111111111111111111111111111------1---11-1-------------------------------------------------------235212222222-2-11---111----13--22222225-33222-22--1212111-----223113131111111111111111-43434345311-2111111111311111131121223222222222211111211-----------------------------1-1-1-122223233422111133221111123223332-222222222222221222111111----------221-2244222223111-313331313----213222222222222-2111111122222112212111-1-12222212222222222222----111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------111211-11111111111111212111111112222122111111-111---------2222222222222221122222223----111111-----------------------------------------12---2---11- ----11------12111112221313111-111111111111111111111212-2221222---------------------------1111111----1-1111-1--21323121-1-1-122121372121311112111111-113113121121171311-21112211111-8-11111-121111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 357 STR:RPRED 86.0 SQ:SECSTR ####################EEEEGGGGTTccccccEEcccccccccEEccccEEEcTTTGTTcccccccccccccccHHHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHTTTccEEEEcccHHHHHHHHHHHccTTccccccEEEEEccccHHHHHHHHHHHTccEEEccGGGGccHHHHHHHHHHHHHHHTcccccccEEEccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccEETTccEEEEEcHHHHHHHHHHHTccEEEEEEEEETTEEEEEEccccEEcEEEEEcTTcccTTHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEE####cccEEEEcccT##TcHHHHHHHcc################################ DISOP:02AL 414-416| PSIPRED cccHHHHHHHHHHHccccccEEEEHHHHcccEEcccccccccccccccccccEEEEEHHHHccccccccEEEEEEEEEcccccccccccccccEEEEcccccccccccEEEEEEEEEEEccccEEEEEccccccccccccccccccccEEEccccEEcHHHHHHHHHccccEEEEccccEEEEEEccHHHcccccccccEEEEccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEEEEcccccEEEEEEcccccHHHHHHHHccEEEEEcccccccccccEEEEEEcccccEEEEc //