[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : moeB
DDBJ      :moeB         molybdopterin biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  702/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.111.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->248 1jw9B PDBj 4e-33 33.9 %
:RPS:PDB   1->251 3cmmA PDBj 1e-38 18.0 %
:RPS:SCOP  3->248 1jw9B  c.111.1.1 * 6e-55 34.3 %
:HMM:SCOP  3->248 1jw9B_ c.111.1.1 * 7.5e-82 43.2 %
:RPS:PFM   32->162 PF00899 * ThiF 1e-23 40.5 %
:RPS:PFM   173->248 PF05237 * MoeZ_MoeB 3e-15 38.7 %
:HMM:PFM   32->163 PF00899 * ThiF 1.6e-48 45.5 132/136  
:HMM:PFM   171->248 PF05237 * MoeZ_MoeB 1.1e-23 39.5 76/84  
:BLT:SWISS 3->248 MOCS3_DROMO 2e-48 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21224.1 GT:GENE moeB GT:PRODUCT molybdopterin biosynthesis protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(392541..393296) GB:FROM 392541 GB:TO 393296 GB:DIRECTION - GB:GENE moeB GB:PRODUCT molybdopterin biosynthesis protein GB:NOTE MoeB GB:PROTEIN_ID AAZ21224.1 GB:DB_XREF GI:71062221 GB:GENE:GENE moeB LENGTH 251 SQ:AASEQ MNSQLKKASIERYSRQIVLKDIGTIGQKKIISSKVLIVGMGGLGSPVAEFLARAGVGSIGIVDDDKVSLSNLHRQSLYNTSDIEKFKVQVARVKIKKINPSIKIKIYKIRLDKNNFKKIIKDYDYIVDGSDNFSTKFLLNDFCYKFKKILVTGAISKFDGHIFTFNFKNKKIPCLRCFFQDSDISDDLLNCESEGILGTVAGIIGTIQANEVLKKILGIGKSLDGYIFILDLLQLNFRKVKLKKRKNCFCK GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 3->248|MOCS3_DROMO|2e-48|41.2|245/452| SEG 94->109|kikkinpsikikiyki| BL:PDB:NREP 1 BL:PDB:REP 3->248|1jw9B|4e-33|33.9|236/240| RP:PDB:NREP 1 RP:PDB:REP 1->251|3cmmA|1e-38|18.0|245/1001| RP:PFM:NREP 2 RP:PFM:REP 32->162|PF00899|1e-23|40.5|131/135|ThiF| RP:PFM:REP 173->248|PF05237|3e-15|38.7|75/84|MoeZ_MoeB| HM:PFM:NREP 2 HM:PFM:REP 32->163|PF00899|1.6e-48|45.5|132/136|ThiF| HM:PFM:REP 171->248|PF05237|1.1e-23|39.5|76/84|MoeZ_MoeB| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00899|IPR000594| RP:SCP:NREP 1 RP:SCP:REP 3->248|1jw9B|6e-55|34.3|236/240|c.111.1.1| HM:SCP:REP 3->248|1jw9B_|7.5e-82|43.2|243/0|c.111.1.1|1/1|Activating enzymes of the ubiquitin-like proteins| OP:NHOMO 1462 OP:NHOMOORG 939 OP:PATTERN --1-1111111111111111111211111121111---111112321211111-13111221112-11 2111122222221211122-2111112222211111111113121122111-111111--11111111111----1111-1-11111111111-22---11211121111---------------1111111111111111---12122122111111111111111322211111111111111-11---1125555544555555551133235542-11-1-1111113232222222222222233322-------1---11-1------1--------1---------------------------------------322211111111111-12212212-2121121122134--1313213111121111111111111111111211111111111111-11111111111-11111111112111111212111122211111111111111111111111111-------------------111111111111111111111111111111121111111-11111111111111111111111111111112122111-2-2-1--1-----343-43422212221-11----111111-11111111121-1113324112132121221222222222221221-11212------22241222222222222-222222222222222222223233332222222222222222221122222--333343333343---211111221111412424122111113222111111111131321211121111111112----11--13333333333323311111111121111112-11------------1----------------------------11---1---111 1121112-51113411121122222223332221112113-22322213222222121122211212211221132212223322111-1211121212122112-11112221121-111-1-11-21131-111-1--1-11111--11--1-1-1111-13111112122113-21E121113-121242211113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR ccTTTTcccccTTHHHHHHHHHcHHHHHHHHTcEEEEEcccHHHHHHHHHHTccTTcEEEEEccccccGGGTTTcTTccGGGTTccHHHHHHHHHHHHcGGGTTTEEEEccTTTccHHHHHHccEEEEccccHHHHHHHHHHHHHHTccEEEEEEETTEEEEEEEcTHHTTcccGGGccccccccccHHHHHHHTccccHHHHHHHHHHHHHHHHTHHHHHHHHHHHcTTHHHHHHcccHHHHHHHHHHHc DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHcccccccccHHHHHHHHcccEEEEEccHHHHHHHHHHHHccccEEEEEEccEEcHHHHccEEEccHHHcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccEEEEEEEccEEEEEEEEEcccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEEccccccccc //