[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : msrB
DDBJ      :msrB         Peptide methionine sulfoxide reductase
Swiss-Prot:MSRA_PELUB   RecName: Full=Peptide methionine sulfoxide reductase msrA;         Short=Protein-methionine-S-oxide reductase;         EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase;         Short=Peptide Met(O) reductase;

Homologs  Archaea  31/68 : Bacteria  781/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->146 2j89A PDBj 1e-33 45.1 %
:RPS:PDB   1->146 3e0mC PDBj 2e-50 37.5 %
:RPS:SCOP  1->146 1ff3A  d.58.28.1 * 6e-54 41.8 %
:HMM:SCOP  1->146 1ff3A_ d.58.28.1 * 2.3e-56 52.7 %
:RPS:PFM   2->146 PF01625 * PMSR 5e-40 52.4 %
:HMM:PFM   3->146 PF01625 * PMSR 7.4e-59 55.6 144/156  
:BLT:SWISS 1->147 MSRA_PELUB 2e-85 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21009.1 GT:GENE msrB GT:PRODUCT Peptide methionine sulfoxide reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 188118..188561 GB:FROM 188118 GB:TO 188561 GB:DIRECTION + GB:GENE msrB GB:PRODUCT Peptide methionine sulfoxide reductase GB:PROTEIN_ID AAZ21009.1 GB:DB_XREF GI:71062006 GB:GENE:GENE msrB LENGTH 147 SQ:AASEQ MEIAVLGLGCFWGPEIKFSKLEGVIKTEVGYCGGDSKTVTYKEVCTCNTNHAEVVKLDFDPKIISYEKILNFFFEIHDPTTLNSQGPDFGTQYRSEIFYLSDRQKEIAESVIKKVNLKLSGNVVTKSSLLKNYCPAEEYHQRYLEKR GT:EXON 1|1-147:0| SW:ID MSRA_PELUB SW:DE RecName: Full=Peptide methionine sulfoxide reductase msrA; Short=Protein-methionine-S-oxide reductase; EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; SW:GN Name=msrA; OrderedLocusNames=SAR11_0188; SW:KW Complete proteome; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|MSRA_PELUB|2e-85|100.0|147/147| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 2->146|2j89A|1e-33|45.1|144/182| RP:PDB:NREP 1 RP:PDB:REP 1->146|3e0mC|2e-50|37.5|144/313| RP:PFM:NREP 1 RP:PFM:REP 2->146|PF01625|5e-40|52.4|145/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 3->146|PF01625|7.4e-59|55.6|144/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 1->146|1ff3A|6e-54|41.8|146/211|d.58.28.1| HM:SCP:REP 1->146|1ff3A_|2.3e-56|52.7|146/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1522 OP:NHOMOORG 996 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241142--------------111111111111111111112-222211211222222221212223122222222122211111--111122222222222222222111122221132331111111633333323333333333333112122321-133112211111222211122222112222222222222222222222222112221111-11111112222-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122231111122222222111122421111112231213-11111111121212112221111-111111111221111212112111111111122121111212111111111111111111111111-11211112121422432322223252222222222---2111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122222222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1D12232221111111121111461-2141111111111111-111111112211141113221-1221456c3342353461677442229 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHccHTcEEEEEEEEETTTccHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHHHHHccccccEEEEcccEEEccTTTTTHHHHc DISOP:02AL 146-147| PSIPRED ccEEEEEcccHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHccccccccEEcccccccccEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHcc //