[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mucA
DDBJ      :mucA         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  307/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
b.87.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->113 1jhhA PDBj 4e-11 37.0 %
:RPS:PDB   22->128 1ay9A PDBj 6e-20 34.3 %
:RPS:SCOP  5->128 1jhcA  b.87.1.1 * 3e-20 29.5 %
:HMM:SCOP  2->129 1jhfA2 b.87.1.1 * 9.4e-28 38.9 %
:HMM:PFM   45->113 PF00717 * Peptidase_S24 1.2e-13 28.4 67/70  
:BLT:SWISS 4->125 MUCA_SALTY 2e-21 41.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21456.1 GT:GENE mucA GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(621992..622387) GB:FROM 621992 GB:TO 622387 GB:DIRECTION - GB:GENE mucA GB:PRODUCT hypothetical protein GB:NOTE similar to COG1974: SOS-response transcriptional repressors (RecA-mediated autopeptidases) GB:PROTEIN_ID AAZ21456.1 GB:DB_XREF GI:71062453 GB:GENE:GENE mucA LENGTH 131 SQ:AASEQ MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKPKNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHSTY GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 4->125|MUCA_SALTY|2e-21|41.3|121/146| BL:PDB:NREP 1 BL:PDB:REP 11->113|1jhhA|4e-11|37.0|100/197| RP:PDB:NREP 1 RP:PDB:REP 22->128|1ay9A|6e-20|34.3|105/108| HM:PFM:NREP 1 HM:PFM:REP 45->113|PF00717|1.2e-13|28.4|67/70|Peptidase_S24| RP:SCP:NREP 1 RP:SCP:REP 5->128|1jhcA|3e-20|29.5|122/130|b.87.1.1| HM:SCP:REP 2->129|1jhfA2|9.4e-28|38.9|126/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 408 OP:NHOMOORG 310 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------131--------------------111----------11-1--11-----1----2-1---------------1---11111121----------3--------11111111-1------111111111111-----------111111111111111------111---------------------------------------------------------------------------------------------------------1--11---------11-111111-11-------11-----------1---------------1------------------------12-11411---------------------------------------1----1----------------11-------------1-----1111-111111111111111111111111-1111211112----122---1-1-1411--------2-1----2--111-11111------11--------1--------------------------1-21--312-111-22521121111-11-111----121------22111311111121211-1113121111111111112531--1123212131241334224211211111-211111111211---1-----3221-2121-----1------11-21131-1---1-11211312111322224---------1-111---1-1--1----11-----------2-----------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------1-------------------------------------------------------------------------------------1------------------------------1---------------------------- STR:NPRED 118 STR:RPRED 90.1 SQ:SECSTR ##########cccTTccTTcGccccccccHHHHHcccGGGEEEEEccccTTGGGTccTTcEEEEEccccccTTcEEEEEETTEEEEEEEEccccccEEEcccTTccccEEccTTccEEEEEEEEEEEc### DISOP:02AL 131-132| PSIPRED cEEEccEEEEEEEcccccccccccccEEEccHHHcccHHHEEEEEEEcccccccccccccEEEEEcccccccccEEEEEEccEEEEEEEEEEccEEEEEEccccccccEEccccccEEEEEEEEEEEEccc //