[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : murB
DDBJ      :murB         UDP-N-acetylenolpyruvoylglucosamine reductase
Swiss-Prot:MURB_PELUB   RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;         EC=1.1.1.158;AltName: Full=UDP-N-acetylmuramate dehydrogenase;

Homologs  Archaea  1/68 : Bacteria  581/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.146.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   109->301 1hskA PDBj 2e-24 31.6 %
:RPS:PDB   21->295 1e0yA PDBj 7e-24 10.0 %
:RPS:SCOP  3->191 1hskA1  d.145.1.2 * 1e-25 28.1 %
:RPS:SCOP  192->301 1hskA2  d.146.1.1 * 8e-19 31.7 %
:HMM:SCOP  21->215 1uxyA1 d.145.1.2 * 1.8e-42 32.8 %
:HMM:SCOP  195->301 1hskA2 d.146.1.1 * 8.5e-23 34.6 %
:RPS:PFM   199->301 PF02873 * MurB_C 1e-08 35.3 %
:HMM:PFM   198->301 PF02873 * MurB_C 2.2e-26 37.9 103/105  
:HMM:PFM   37->165 PF01565 * FAD_binding_4 1.8e-18 22.8 127/138  
:BLT:SWISS 1->302 MURB_PELUB e-174 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20847.1 GT:GENE murB GT:PRODUCT UDP-N-acetylenolpyruvoylglucosamine reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(24127..25035) GB:FROM 24127 GB:TO 25035 GB:DIRECTION - GB:GENE murB GB:PRODUCT UDP-N-acetylenolpyruvoylglucosamine reductase GB:PROTEIN_ID AAZ20847.1 GB:DB_XREF GI:71061844 GB:GENE:GENE murB LENGTH 302 SQ:AASEQ MSIEEIRKFSNEISSKINFDYDLKKSNWFNIGGQTKVYFRPDNLPDLILFLKKFGEKEKIHILGAGSNTLISDEKFDGVVIKLGKNFSNISILPNDVIIAGSACLDKKLSDFALNNGIGGFEFLACIPGTIGGGLKMNAGCFNKEFKDVLVSIQAIDKNGQVFTIPASKVIFKYRSNDLKEDLIFLSASFKGTKKNKEEIENEVLELKKKKDKAQPTKLKTSGSTFKNPIDQTDKKVWKLIKDSVPLDISFGDAHISNKHCNFFVNKNNASFEDMNKLIEFVKISVEKKTGIVLEKEIKILK GT:EXON 1|1-302:0| SW:ID MURB_PELUB SW:DE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase; EC=1.1.1.158;AltName: Full=UDP-N-acetylmuramate dehydrogenase; SW:GN Name=murB; OrderedLocusNames=SAR11_0022; SW:KW Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm; FAD;Flavoprotein; NADP; Oxidoreductase; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->302|MURB_PELUB|e-174|100.0|302/302| GO:SWS:NREP 8 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| BL:PDB:NREP 1 BL:PDB:REP 109->301|1hskA|2e-24|31.6|190/303| RP:PDB:NREP 1 RP:PDB:REP 21->295|1e0yA|7e-24|10.0|269/550| RP:PFM:NREP 1 RP:PFM:REP 199->301|PF02873|1e-08|35.3|102/128|MurB_C| HM:PFM:NREP 2 HM:PFM:REP 198->301|PF02873|2.2e-26|37.9|103/105|MurB_C| HM:PFM:REP 37->165|PF01565|1.8e-18|22.8|127/138|FAD_binding_4| GO:PFM:NREP 3 GO:PFM GO:0008762|"GO:UDP-N-acetylmuramate dehydrogenase activity"|PF02873|IPR011601| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF02873|IPR011601| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02873|IPR011601| RP:SCP:NREP 2 RP:SCP:REP 3->191|1hskA1|1e-25|28.1|185/194|d.145.1.2| RP:SCP:REP 192->301|1hskA2|8e-19|31.7|104/109|d.146.1.1| HM:SCP:REP 21->215|1uxyA1|1.8e-42|32.8|189/0|d.145.1.2|1/1|FAD-binding domain| HM:SCP:REP 195->301|1hskA2|8.5e-23|34.6|104/109|d.146.1.1|1/1|Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain| OP:NHOMO 624 OP:NHOMOORG 589 OP:PATTERN ---------------------------------------------------1---------------- 1-11--1-221----11-------1------------1-----------1--------------1-------------2122121111-----------11111-11-1111111111111111111111211113---11---1-11111111111111111111111111111111111111111111111122222222222222211111122221111111111112111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111-----111111111111111111111111111--------1-------------------------1--------1------1-1111--1111111111---1111111111111-121311111111111-11111111111111111111111111111------1-1-1-1111--11111--111-1--11111-1------1--------------------------------------11-----------------------------------------1-11111111111----111--1-111-111------------------------------111111111-111-------1---11--------11111112111111111111111---------------------------1111111111111 ---------------------1-1-11-----------------------------------------------------------------------------------------------------------------------------------1--------------------------1-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 97.0 SQ:SECSTR ########GGcccccccTTccccccccccTTcccccEEEccccHHHHHHHHHHHHHTccEEEEcccccTTTccccTTcEEEEcTTcccEEEEETTTEEEEcTTccHHHHHHHHHTTTGGGTEEccccccccccHHHHHHTTcccccTGGccccEEEETTccEEEcGGGGccccccGGGTTccGccccTTTTTcTTcccccGEEEEEEEEEcHHHEEccccEEEEEEEEcEEccTTHHHHHHHHHHHHHHTTccccccEEEEHHHHHHHHcccTTTccccccccHHHHHHHHHHHTcccEEE# DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHcccEEEccccccccccccccEEEEEEEEccHHHHHHHHHHHHccccEEEEEccEEEEEccccccEEEEEEcccccEEEEccccEEEEEEcccHHHHHHHHHHccccccHHHHccccHHccHHHHccccccHHHHEEEEEEEEEcccccEEEEcHHHHccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHcccccEEEccEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHccEEEcccEEEc //