[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : murD
DDBJ      :murD         UDP-N-acetylmuramoylalanine--D-glutamate ligase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  576/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.5.1c.59.1c.72.2
:431 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->204,400->427 1eehA PDBj 6e-11 31.2 %
:RPS:PDB   107->425 1e8cB PDBj 7e-27 11.6 %
:RPS:SCOP  107->226 1e8cA3  c.72.2.1 * 1e-21 29.4 %
:RPS:SCOP  292->428 1e0dA2  c.59.1.1 * 1e-13 26.9 %
:HMM:SCOP  6->91 2uagA1 c.5.1.1 * 0.00017 17.4 %
:HMM:SCOP  95->286 2uagA3 c.72.2.1 * 9.7e-34 30.1 %
:HMM:SCOP  288->430 2uagA2 c.59.1.1 * 1.1e-21 31.6 %
:RPS:PFM   109->214 PF08245 * Mur_ligase_M 5e-13 35.2 %
:HMM:PFM   109->229 PF08245 * Mur_ligase_M 1.5e-35 42.0 119/188  
:HMM:PFM   46->90 PF02302 * PTS_IIB 0.00086 23.3 43/90  
:BLT:SWISS 31->425 MURD_RICBR 1e-42 33.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20851.1 GT:GENE murD GT:PRODUCT UDP-N-acetylmuramoylalanine--D-glutamate ligase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(28611..29906) GB:FROM 28611 GB:TO 29906 GB:DIRECTION - GB:GENE murD GB:PRODUCT UDP-N-acetylmuramoylalanine--D-glutamate ligase GB:PROTEIN_ID AAZ20851.1 GB:DB_XREF GI:71061848 GB:GENE:GENE murD LENGTH 431 SQ:AASEQ MLNLEKNFLKKKILIYGLGKSGLSTYSYLKKNNIISLYDDQIITKKNIKDTHTTYKEIIKKEFDCIIISPGIDINNCKLSRFLKKNHKKIYTDLDIFYSRYAFNQKITITGTNGKSTTAKLLYDILKDQKKDVRLVGNIGNPVLLEKKIKKDTLFVIEASSYQLEYSKLFKTNISLILNISPDHLERHKTINKYVSAKFKLIKNQSKNDIAILNTKNFYIKRKLKQKKFAPSILKIEKYISDRFIKKIDNHYFDTDGNKENLTFVLKVSKILKLKNNLLLKSLKNFKGLSFRQEIIHNSKFLKIINDSKATSFSSSEKLLKSLKNIYWIVGGLPKKRDKFLLKKNDCKKIKLYIFGKNQKFFINELKNKMAFKSFLNLKSLIAKVFLDIKNENNFIKKTILFSPASASFDTFKNFEERGRYFNKLIKNYIK GT:EXON 1|1-431:0| BL:SWS:NREP 1 BL:SWS:REP 31->425|MURD_RICBR|1e-42|33.1|390/450| SEG 9->24|lkkkiliyglgksgls| SEG 264->291|fvlkvskilklknnlllkslknfkglsf| SEG 312->324|sfsssekllkslk| BL:PDB:NREP 1 BL:PDB:REP 64->204,400->427|1eehA|6e-11|31.2|166/431| RP:PDB:NREP 1 RP:PDB:REP 107->425|1e8cB|7e-27|11.6|311/484| RP:PFM:NREP 1 RP:PFM:REP 109->214|PF08245|5e-13|35.2|105/187|Mur_ligase_M| HM:PFM:NREP 2 HM:PFM:REP 109->229|PF08245|1.5e-35|42.0|119/188|Mur_ligase_M| HM:PFM:REP 46->90|PF02302|0.00086|23.3|43/90|PTS_IIB| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 2 RP:SCP:REP 107->226|1e8cA3|1e-21|29.4|119/234|c.72.2.1| RP:SCP:REP 292->428|1e0dA2|1e-13|26.9|130/140|c.59.1.1| HM:SCP:REP 6->91|2uagA1|0.00017|17.4|86/93|c.5.1.1|1/1|MurCD N-terminal domain| HM:SCP:REP 95->286|2uagA3|9.7e-34|30.1|186/204|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 288->430|2uagA2|1.1e-21|31.6|136/140|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 605 OP:NHOMOORG 582 OP:PATTERN -------------------------------------------------------------------- 11111-------------------------------------------1----1-1--11-------1111-------111111111-111111111--111111111-1-------11-----11-11111-111-----------------11--111111--------1111111111-1---11111111111111111111111111111111111--11111111111111111111111111111--111--11111--11--1-11-11111111111111-----------11111111111111111111111111111111111-1-12112111121211111111111121111111112-1-111111111111111111111111111111111-111111111111111111111111111111111111111--------1--1111111--------11111111111311211112111111--------------------------------1------1111111111---1111-1111111111---2111111-11111-111111111111-111111----11111111111111-12111--1111111111111111111111111111111-1111111-1111-1-1--------------------------------111--11-------------------------111---1----1111111111111111111111111111111111112222222-1-1111111--111111-111111111111111-1-----11---1-1-----------211-111111111111111---------------------------1111111111-11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------2--1--2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 389 STR:RPRED 90.3 SQ:SECSTR #######################################cEEccccccccGGGGHHHHHHHTccEEEEccccccccEHHHHEEcccHHHHHHHHHHHHHHHHccEEHHHHHHTTccEEEcTTccEETTccccccccccHHHHHHHHHHHHTTccEEEEccHHHHTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHccccccccEEEEETTcHHHHHHHTTcTTcEEEEcccccTTTccEEEEEEEEEccccHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTccEEEEEccccHHHHHHHHHTccccEEEEEccccccccTHHHHHHHHHHHccEEEETcccccccTccHHHHHGHHHHTTccTTccEEccHHHHHHHHHHEEEEEcEccTTccEEEETTEEEEccHHHHH### DISOP:02AL 1-4| PSIPRED ccccHHHHcccEEEEEEEcHHHHHHHHHHHHcccEEEEEcHHHHccccHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHcccccEEEEEcccccHHHHHcccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHccccEEEEEEccEEEccccEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccEEEEEEcccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHccEEEEEEcccHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHcccHHHHHHHHHHHHHHHcc //