[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mutM
DDBJ      :mutM         Formamidopyrimidine-DNA glycosylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  719/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->287 1pm5A PDBj 6e-36 35.0 %
:RPS:PDB   2->287 1ee8A PDBj 2e-62 30.8 %
:RPS:SCOP  3->139 1kfvA2  b.113.1.1 * 1e-22 27.6 %
:RPS:SCOP  146->233 1ee8A1  a.156.1.2 * 6e-27 33.0 %
:RPS:SCOP  234->287 1ee8A3  g.39.1.8 * 9e-17 34.6 %
:HMM:SCOP  2->154 1nnjA2 b.113.1.1 * 2.8e-32 33.6 %
:HMM:SCOP  146->239 1r2zA1 a.156.1.2 * 9.1e-30 42.6 %
:HMM:SCOP  233->287 1ee8A3 g.39.1.8 * 7.5e-14 43.4 %
:RPS:PFM   2->127 PF01149 * Fapy_DNA_glyco 5e-13 36.0 %
:RPS:PFM   145->236 PF06831 * H2TH 4e-19 44.0 %
:HMM:PFM   2->129 PF01149 * Fapy_DNA_glyco 1.5e-33 36.3 113/116  
:HMM:PFM   145->235 PF06831 * H2TH 5.8e-29 38.5 91/93  
:HMM:PFM   260->287 PF06827 * zf-FPG_IleRS 3e-08 46.2 26/30  
:BLT:SWISS 1->286 FPG_LEGPH 5e-59 43.9 %
:PROS 260->286|PS01242|ZF_FPG_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21229.1 GT:GENE mutM GT:PRODUCT Formamidopyrimidine-DNA glycosylase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 397259..398122 GB:FROM 397259 GB:TO 398122 GB:DIRECTION + GB:GENE mutM GB:PRODUCT Formamidopyrimidine-DNA glycosylase GB:PROTEIN_ID AAZ21229.1 GB:DB_XREF GI:71062226 GB:GENE:GENE mutM LENGTH 287 SQ:AASEQ MPELPEVEIVKQSLSKKLEHKKIKKIIITNRNLRFKIPLKFEELLKNKIIKKVTRFSKYLILNFSDQSFCLIHLGMSGTVHLIKKNNISKFTNTSFYNSPSLPKKHNHVEIHFKGLRVIYNDPRRFGFFKFIENKKELEKRFSHLGPEPFFKNFNLEYLIGYFTNKKKDIKSFLLDQKFVSGIGNIYASEILFLCKINPITYASKLTKQDCKKIITYSKSVLNRAIKKGGSSIRDFKNITGKSGNFQKEFRVYQRENLSCLRTKCNGKIQKIFISNRSTFFCNTCQK GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 1->286|FPG_LEGPH|5e-59|43.9|269/274| PROS 260->286|PS01242|ZF_FPG_1|PDOC00956| SEG 21->28|kkikkiii| BL:PDB:NREP 1 BL:PDB:REP 2->287|1pm5A|6e-36|35.0|266/271| RP:PDB:NREP 1 RP:PDB:REP 2->287|1ee8A|2e-62|30.8|260/266| RP:PFM:NREP 2 RP:PFM:REP 2->127|PF01149|5e-13|36.0|114/118|Fapy_DNA_glyco| RP:PFM:REP 145->236|PF06831|4e-19|44.0|91/92|H2TH| HM:PFM:NREP 3 HM:PFM:REP 2->129|PF01149|1.5e-33|36.3|113/116|Fapy_DNA_glyco| HM:PFM:REP 145->235|PF06831|5.8e-29|38.5|91/93|H2TH| HM:PFM:REP 260->287|PF06827|3e-08|46.2|26/30|zf-FPG_IleRS| GO:PFM:NREP 10 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF01149|IPR012319| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF01149|IPR012319| GO:PFM GO:0006284|"GO:base-excision repair"|PF01149|IPR012319| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01149|IPR012319| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF01149|IPR012319| GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| RP:SCP:NREP 3 RP:SCP:REP 3->139|1kfvA2|1e-22|27.6|123/131|b.113.1.1| RP:SCP:REP 146->233|1ee8A1|6e-27|33.0|88/89|a.156.1.2| RP:SCP:REP 234->287|1ee8A3|9e-17|34.6|52/56|g.39.1.8| HM:SCP:REP 2->154|1nnjA2|2.8e-32|33.6|131/131|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 146->239|1r2zA1|9.1e-30|42.6|94/0|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 233->287|1ee8A3|7.5e-14|43.4|53/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 822 OP:NHOMOORG 765 OP:PATTERN -------------------------------------------------------------------- 121121111111-112222-22113222222222221211111121111111222112--11112122221-----------3----------1---------1-1--1---------------1-----------11-1111111111111111111111111111111111121111121111111---111111111111111111211111111111111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------------------1----1--112211111111-------2-11111111111111121111111111111111-1-1111111111111111111111111111111111111111111111111111111111-1111----1-1111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111111111111--1-1-1--------------------------111111111111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111-111111111111111111111111111111111111112111111111111111111111112222111-----------------111111-1111111111111111111------------- --------------1111-1--1111-111111------------1--111111111-1111------------------------------1----------1-1--2--------------------------------1---------------------1-------------21-11--23221-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 99.7 SQ:SECSTR #ccHHHHHHHHHHHHHHHTTcEEEEEEEEEEEcccTTTEEcGGGGTTEEEEEEEEETTEEEEEETTTEEEEEEcTTTcEEEccHHHHHHcHHHHHEEcTTccccTTEEEEEEEcccEEEEEcTTcccEEEEETTccTTcTHHHHccccTTcTTccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTcccccccccTTccccccGGGcccTTcTTcccTTcTTccccEEEEccccEEEEcTTTTT DISOP:02AL 287-288| PSIPRED cccccHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHcccEEEEEEEEcEEEEEEEccccEEEEEccccEEEEEEccccccccccccccccccccccccEEEEEEcccEEEEEcccccEEEEEEccHHHHHHHHHHcccccccccccHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccEEEEEEEccccEEEcccccc //