[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : nadA
DDBJ      :nadA         Quinolinate synthetase A protein
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  632/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.145.1
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->247 2qs0A PDBj 6e-46 48.5 %
:RPS:PDB   11->103 2arhC PDBj 1e-13 6.5 %
:RPS:SCOP  34->327 1wzuA1  c.145.1.1 * 2e-19 38.1 %
:HMM:SCOP  31->327 1wzuA1 c.145.1.1 * 5.3e-110 49.0 %
:RPS:PFM   37->324 PF02445 * NadA 3e-74 49.5 %
:HMM:PFM   35->326 PF02445 * NadA 1.8e-118 52.2 291/296  
:BLT:SWISS 1->324 NADA_RHISN e-118 60.5 %
:REPEAT 2|96->177|181->262

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21441.1 GT:GENE nadA GT:PRODUCT Quinolinate synthetase A protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(608585..609574) GB:FROM 608585 GB:TO 609574 GB:DIRECTION - GB:GENE nadA GB:PRODUCT Quinolinate synthetase A protein GB:PROTEIN_ID AAZ21441.1 GB:DB_XREF GI:71062438 GB:GENE:GENE nadA LENGTH 329 SQ:AASEQ MEFTEEVKKATDPIYQKISKVLPEIEWSVHAPYIHRINQLKKEKNAVILAHNYQTPEIYHGVADFAADSLALAIEASKTSADIIVMAGVHFMAETAKLMSPQKKVLLPDMLAGCSLSSSITGKDVRLLKEKYPGVPVVSYVNTSADVKAETDICCTSANAVKIVNSLGVKKVIFLPDDYLAKYVASQTDVEIIAWKGICIVHDQFNEKEIHDIRKNNPGIKIIAHPECPPDVIKASDFAGSTSGMIKYVEDNQPKKVMMVTECSMSDNIQVENPNVEFIKPCNLCPHMKRITLPKILACLENETGEIIMDNETINKARIPVERMTAIGR GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 1->324|NADA_RHISN|e-118|60.5|324/359| NREPEAT 1 REPEAT 2|96->177|181->262| BL:PDB:NREP 1 BL:PDB:REP 45->247|2qs0A|6e-46|48.5|198/294| RP:PDB:NREP 1 RP:PDB:REP 11->103|2arhC|1e-13|6.5|92/188| RP:PFM:NREP 1 RP:PFM:REP 37->324|PF02445|3e-74|49.5|287/296|NadA| HM:PFM:NREP 1 HM:PFM:REP 35->326|PF02445|1.8e-118|52.2|291/296|NadA| GO:PFM:NREP 2 GO:PFM GO:0008987|"GO:quinolinate synthetase A activity"|PF02445|IPR003473| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02445|IPR003473| RP:SCP:NREP 1 RP:SCP:REP 34->327|1wzuA1|2e-19|38.1|268/271|c.145.1.1| HM:SCP:REP 31->327|1wzuA1|5.3e-110|49.0|294/0|c.145.1.1|1/1|NadA-like| OP:NHOMO 693 OP:NHOMOORG 683 OP:PATTERN ---1-1-11--11111-11---1-111111-111111111111111121221111111111-----11 11111-111111-111111-11111111111111111111111111111--1111111--111-1111111----111----11111111111111---1-1---1-111---------------111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111-1111111-11---------------1--------------------------------------------------------------------------11-111111111-1111111111--1---1111111111111----1-1-1111111-----1111111111111----------1-11111111121-111111111111-1111--1-----1111111111111-11111111111111-------------------111111----111111111111111111111111111111111111111111111111111111111111111111111-111111211111111111121111111211--1-------11111111111111111111111111112111111111111111111--1111------1111-111111111111-11111111111111111111111111-11111111111111111111111-11111111111111--1111111111111111---------------11111111111111111111111111111111111111111111111111111----------1111111-111111---------------------------------------111-111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 96.4 SQ:SECSTR #HHHHHHHHTHHHHHTTccEEEEEcTTcHHHHHHTTccGGGcHHHHHTTTccEEEEEEccHTTTTTcEEEEEEccccHHHHHHHHHHHHTTccccTHHHHHHHEEHHHHHHHHTcccTTccTccHHHHHTccccHHHHHHHHHHHHHHTTccEEEcTTTHHHHHHHccccEEEEEccHHHHHHHHHHHccEEEEccccccTGGGccHHHHHHHHTccccccEEEcTTccHHHHTTccccccHHHHHH##HGGGccEEEEEccTHHHHHHHHHcTTcEETTTTccc####cccHHHHHHHHHHTcccccccHHHHHHHHHHHHHH##### DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccEEEEccccccccHHHcccHHHHHHHHHHcccccEEEEEcccHHHHHcccEEEEcHHHHHHHHHcccccEEEcccHHHHHHHHHHHccEEEEEccEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHccccccHHHHHHHHHHccccEEEEEEcHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHcccc //