[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ndufs4
DDBJ      :ndufs4       ETC complex I subunit conserved region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  133/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->79 2jyaA PDBj 9e-13 38.2 %
:RPS:PFM   3->91 PF04800 * ETC_C1_NDUFA4 2e-18 47.2 %
:HMM:PFM   3->92 PF04800 * ETC_C1_NDUFA4 1.1e-32 41.1 90/101  
:BLT:SWISS 2->91 NDUS4_GECJA 3e-19 43.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21814.1 GT:GENE ndufs4 GT:PRODUCT ETC complex I subunit conserved region GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 986302..986583 GB:FROM 986302 GB:TO 986583 GB:DIRECTION + GB:GENE ndufs4 GB:PRODUCT ETC complex I subunit conserved region GB:PROTEIN_ID AAZ21814.1 GB:DB_XREF GI:71062811 GB:GENE:GENE ndufs4 LENGTH 93 SQ:AASEQ MKKAKIYIPTKNSMQSGLGKSDKWLIEFKTEDTGINPLMGWETNSNTLSELNLEFSSKELAIEYAKKNKIDFEIIEPQKRKTVKKSYADNFLK GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 2->91|NDUS4_GECJA|3e-19|43.3|90/175| BL:PDB:NREP 1 BL:PDB:REP 4->79|2jyaA|9e-13|38.2|76/80| RP:PFM:NREP 1 RP:PFM:REP 3->91|PF04800|2e-18|47.2|89/96|ETC_C1_NDUFA4| HM:PFM:NREP 1 HM:PFM:REP 3->92|PF04800|1.1e-32|41.1|90/101|ETC_C1_NDUFA4| GO:PFM:NREP 3 GO:PFM GO:0005743|"GO:mitochondrial inner membrane"|PF04800|IPR006885| GO:PFM GO:0016651|"GO:oxidoreductase activity, acting on NADH or NADPH"|PF04800|IPR006885| GO:PFM GO:0022900|"GO:electron transport chain"|PF04800|IPR006885| OP:NHOMO 239 OP:NHOMOORG 228 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111-1-111111111111111111121111111--------111-1-111111111111---------------111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-----111111-11111111111111111-1111111111111--1--11111--1----------1---------------11111111111-11112-1-1--211111--113111-1-141-121111111121111111--1121111--1-111111111111111------1111111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 81.7 SQ:SECSTR ###EEEEcccccccTTTTcccccEEEEEEEEcccccTTTccccccccEEEEEEEEccHHHHHHHHHHHTcEEEEcccTT############## DISOP:02AL 92-94| PSIPRED ccEEEEEccccccccEEcccccEEEEEEccccccccccccEEEcccccccEEEEEccHHHHHHHHHHccccEEEEcccccccccccHHHcccc //