[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : norM
DDBJ      :norM         matE efflux family protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  320/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:456 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->163 PF01554 * MatE 2e-10 28.9 %
:RPS:PFM   265->396 PF01554 * MatE 1e-07 30.3 %
:HMM:PFM   22->182 PF01554 * MatE 4.5e-33 31.7 161/162  
:HMM:PFM   247->400 PF01554 * MatE 1.1e-25 22.7 154/162  
:HMM:PFM   430->454 PF07664 * FeoB_C 0.00011 32.0 25/54  
:BLT:SWISS 9->383 MEPA_STAAW 4e-22 21.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21877.1 GT:GENE norM GT:PRODUCT matE efflux family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1039346..1040716) GB:FROM 1039346 GB:TO 1040716 GB:DIRECTION - GB:GENE norM GB:PRODUCT matE efflux family protein GB:NOTE similar to Geobacter sulfurreducens PCA gb|AAR36025.1| MATE efflux family protein GB:PROTEIN_ID AAZ21877.1 GB:DB_XREF GI:71062874 GB:GENE:GENE norM LENGTH 456 SQ:AASEQ MSKAIKLTKDPIWELLRKVTIPASVGSLFQTFYNLVDTWFAGRISAEAIGAIAKSFPIYFVIIAVGVGIGAATNSCIGNLLGAKKINKASLFIAQSVIFSLVTSIVVTLFGLNASNFLLSVMGSDAAGIALTREYLDIIFYGTFIVMIQISLNGALNAQGDTKSYRNVLIFSFFLNIFLNPLFIWGYGIVPAYGIGGLAIATVIAQSIGTIYLAYKINSCKLRKYLSIKCFIPKFILLKELFAQAMPIMISMLFIGVGIFNILYFIGQFGDLATAGYGAALRVEQVFLLPVIGLNTAVLSIGGQNFGAKNYNRIRELYTKALFFGSSFMAVAGVVLFFGAEFFVSQFTDNVEAIYHGAIYLKVAALIAPIYPVFFITTAVFQALKKPIYSLYLSVLRLTAFPFLSLWYVINIRGGDYADIFYTIMATNWFMGIAVIIFIGYFLNNVFKQKKSHFSY GT:EXON 1|1-456:0| BL:SWS:NREP 1 BL:SWS:REP 9->383|MEPA_STAAW|4e-22|21.4|370/451| TM:NTM 12 TM:REGION 19->40| TM:REGION 53->75| TM:REGION 99->121| TM:REGION 136->157| TM:REGION 166->188| TM:REGION 191->213| TM:REGION 236->258| TM:REGION 287->309| TM:REGION 321->343| TM:REGION 357->379| TM:REGION 389->411| TM:REGION 421->443| SEG 61->72|viiavgvgigaa| SEG 167->184|nvlifsfflniflnplfi| RP:PFM:NREP 2 RP:PFM:REP 22->163|PF01554|2e-10|28.9|142/161|MatE| RP:PFM:REP 265->396|PF01554|1e-07|30.3|132/161|MatE| HM:PFM:NREP 3 HM:PFM:REP 22->182|PF01554|4.5e-33|31.7|161/162|MatE| HM:PFM:REP 247->400|PF01554|1.1e-25|22.7|154/162|MatE| HM:PFM:REP 430->454|PF07664|0.00011|32.0|25/54|FeoB_C| GO:PFM:NREP 10 GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| OP:NHOMO 688 OP:NHOMOORG 355 OP:PATTERN 112-2------------------12223132-33-11-32223--11--2424-1422334------- --1------------------------------------------------------------------------111--12-1111133451432-----2-112-1-1------------------------1-11111---1-2-----------------1-----1------------------1----222221222222112-21113211---1112211222-2-111111111111111---1-12----1-1-221111-1----2221111-11-221111111111111111-1112111-331113332-7638555556696919444444852351D9--3311-236-1122-1431-----1-------------1-1-----------------------1-----------------1--1-----11----------------------------------------------1--1-------------------------------11-1--11---1----1--------------------------11--1----1----2-21221-1-----11--11-------1212111211-1--1--11-1-1222212222223222222222232-------------1--1------1-11------------------------------------------------------------------------1-------------3---------------1111112121-----------------------------123311111534111111111111-------8------222111114-1-------------------------2233222222--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 455-456| PSIPRED cccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //