[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : nusB
DDBJ      :nusB         Antitermination protein NusB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.79.1
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->128 1tzwA PDBj 3e-06 25.6 %
:RPS:PDB   40->130 3d3cA PDBj 6e-14 28.1 %
:RPS:SCOP  12->130 1tztA  a.79.1.1 * 2e-12 24.6 %
:HMM:SCOP  9->126 1q8cA_ a.79.1.2 * 3.1e-27 36.8 %
:HMM:PFM   25->127 PF01029 * NusB 2.8e-19 23.5 102/134  
:BLT:SWISS 40->130 NUSB_RHOPT 8e-12 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21848.1 GT:GENE nusB GT:PRODUCT Antitermination protein NusB GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1014708..1015112) GB:FROM 1014708 GB:TO 1015112 GB:DIRECTION - GB:GENE nusB GB:PRODUCT Antitermination protein NusB GB:PROTEIN_ID AAZ21848.1 GB:DB_XREF GI:71062845 GB:GENE:GENE nusB LENGTH 134 SQ:AASEQ MRTPYNPNQSPRVIIIQKLYGNFFNDDTDLTFPKHRFKKFIKDVVLGTIERDEVIKEEVKKYLSEDLELTNLDQVFQVIVKSAIFEFLYKPKVSSKIIIKEYLDASNFFLEDGQTKYLNAILDKIAKKIRTTNA GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 40->130|NUSB_RHOPT|8e-12|24.2|91/174| BL:PDB:NREP 1 BL:PDB:REP 38->128|1tzwA|3e-06|25.6|90/142| RP:PDB:NREP 1 RP:PDB:REP 40->130|3d3cA|6e-14|28.1|89/138| HM:PFM:NREP 1 HM:PFM:REP 25->127|PF01029|2.8e-19|23.5|102/134|NusB| RP:SCP:NREP 1 RP:SCP:REP 12->130|1tztA|2e-12|24.6|118/141|a.79.1.1| HM:SCP:REP 9->126|1q8cA_|3.1e-27|36.8|117/0|a.79.1.2|1/1|NusB-like| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--1-----11111-----------------1--1---111111111111----1----------------------------------------11-------------11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 95.5 SQ:SECSTR ccc##ccccccccHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHTcHHHHHHHHGGGTTTcccGGcccHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHc#### DISOP:02AL 1-6, 131-134| PSIPRED ccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc //