[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : nusG
DDBJ      :nusG         transcription antitermination protein NusG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  900/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.58.42
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->174 1nppC PDBj 2e-26 44.1 %
:RPS:PDB   55->174 2ckkA PDBj 2e-16 13.3 %
:RPS:SCOP  2->109 1nz8A  d.58.42.1 * 2e-25 29.6 %
:RPS:SCOP  118->174 1m1gA2  b.34.5.4 * 2e-14 50.9 %
:HMM:SCOP  1->112 1nz8A_ d.58.42.1 * 4.1e-31 36.6 %
:HMM:SCOP  118->175 1m1gA2 b.34.5.4 * 1.2e-18 56.9 %
:RPS:PFM   4->100 PF02357 * NusG 1e-16 44.3 %
:HMM:PFM   2->100 PF02357 * NusG 1.4e-23 38.6 88/92  
:HMM:PFM   125->155 PF00467 * KOW 2.9e-08 37.0 27/32  
:BLT:SWISS 2->176 NUSG_PASMU 1e-45 45.1 %
:PROS 158->167|PS01014|NUSG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21931.1 GT:GENE nusG GT:PRODUCT transcription antitermination protein NusG GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1084692..1085222) GB:FROM 1084692 GB:TO 1085222 GB:DIRECTION - GB:GENE nusG GB:PRODUCT transcription antitermination protein NusG GB:PROTEIN_ID AAZ21931.1 GB:DB_XREF GI:71062928 GB:GENE:GENE nusG LENGTH 176 SQ:AASEQ MKNWYIVQSHSNFENKVAGLIKEEAEKAKISDKIEEIVVPTHDVTEVKRGKRIQRKKKYFPGYVLIKSEMDNDLYHLIKNLKRVSGFLGSKGIPVPVSDKEIEKILGQIKDGVAQPKSGIEYSIGEKVQVVDGPFASFSGMVEDIDEEKSRLKVSVSIFGRPTPVDLEYNQVEKAS GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 2->176|NUSG_PASMU|1e-45|45.1|175/183| PROS 158->167|PS01014|NUSG|PDOC00775| BL:PDB:NREP 1 BL:PDB:REP 46->174|1nppC|2e-26|44.1|127/238| RP:PDB:NREP 1 RP:PDB:REP 55->174|2ckkA|2e-16|13.3|113/120| RP:PFM:NREP 1 RP:PFM:REP 4->100|PF02357|1e-16|44.3|88/92|NusG| HM:PFM:NREP 2 HM:PFM:REP 2->100|PF02357|1.4e-23|38.6|88/92|NusG| HM:PFM:REP 125->155|PF00467|2.9e-08|37.0|27/32|KOW| GO:PFM:NREP 2 GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF02357|IPR006645| GO:PFM GO:0032968|"GO:positive regulation of RNA elongation from RNA polymerase II promoter"|PF02357|IPR006645| RP:SCP:NREP 2 RP:SCP:REP 2->109|1nz8A|2e-25|29.6|108/119|d.58.42.1| RP:SCP:REP 118->174|1m1gA2|2e-14|50.9|57/58|b.34.5.4| HM:SCP:REP 1->112|1nz8A_|4.1e-31|36.6|112/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| HM:SCP:REP 118->175|1m1gA2|1.2e-18|56.9|58/58|b.34.5.4|1/1|Translation proteins SH3-like domain| OP:NHOMO 929 OP:NHOMOORG 904 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111132111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111114111111111111111111111111111111111211111112231111111111111111111111211111111111111111-11111511121111111111111111111111112111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1--11111----1111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----2---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 98.9 SQ:SECSTR #cEEEEEEEcTTcHHHHHHHHHHHHHHHTcTTTccccccccccccTTTEEEEEEcccccccTTcEEEEcccTTcGGGTTcEEEEEEEETTTEEEEETTTccEEEEEHHHHHccGGGEEEccccTTcEEEEcccTTTTcEEEEEEEEGGGTEEEEEcccTTTTcEEEEEGGGEEEc# DISOP:02AL 110-118| PSIPRED ccEEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEEcccEEEEEEcccccEEEEEEEccHHHHHHHHccccEEEEEcccccEEEccHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccEEEEEEEcccEEEEEEEHHHccEEEEEEcHHHEEEcc //