[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : oocM
DDBJ      :oocM         octopine-like transport system permease protein oocM
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  679/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:224 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   121->162 3dhwA PDBj 7e-06 34.2 %
:RPS:SCOP  1->223 2r6gG1  f.58.1.1 * 4e-24 12.8 %
:RPS:PFM   40->93 PF04666 * Glyco_transf_54 2e-04 42.6 %
:HMM:PFM   31->221 PF00528 * BPD_transp_1 8.2e-22 20.1 179/185  
:HMM:PFM   13->44 PF01313 * Bac_export_3 0.00034 25.0 32/76  
:BLT:SWISS 1->218 NOCM_AGRT5 6e-58 48.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22014.1 GT:GENE oocM GT:PRODUCT octopine-like transport system permease protein oocM GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1156341..1157015) GB:FROM 1156341 GB:TO 1157015 GB:DIRECTION - GB:GENE oocM GB:PRODUCT octopine-like transport system permease protein oocM GB:PROTEIN_ID AAZ22014.1 GB:DB_XREF GI:71063011 GB:GENE:GENE oocM LENGTH 224 SQ:AASEQ MDFDLMITSLPKLLSAAVITLKLLSASLIIGLFIGFLFAVLRLNKNPFINKFAYGYSYLFRGTPLLVQIFIIYYGLGQIEWLRSTFLWVILKEPYWCAIIAFALNTGAYTSEILRSAFQTIKPGIIEAGKSLGISSKIILYKIQIPVAIRQSLPAYGNEIILMMKGTSLASTVTLMDITGVAKHIVSTTYKPLEVFLLAGGIYLFMTFIFHNLIKYLEKKYSFQ GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 1->218|NOCM_AGRT5|6e-58|48.2|218/241| TM:NTM 5 TM:REGION 13->35| TM:REGION 59->81| TM:REGION 88->110| TM:REGION 129->151| TM:REGION 193->215| RP:PDB:NREP 1 RP:PDB:REP 121->162|3dhwA|7e-06|34.2|38/203| RP:PFM:NREP 1 RP:PFM:REP 40->93|PF04666|2e-04|42.6|47/261|Glyco_transf_54| HM:PFM:NREP 2 HM:PFM:REP 31->221|PF00528|8.2e-22|20.1|179/185|BPD_transp_1| HM:PFM:REP 13->44|PF01313|0.00034|25.0|32/76|Bac_export_3| GO:PFM:NREP 3 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF04666|IPR006759| GO:PFM GO:0016020|"GO:membrane"|PF04666|IPR006759| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF04666|IPR006759| RP:SCP:NREP 1 RP:SCP:REP 1->223|2r6gG1|4e-24|12.8|218/284|f.58.1.1| OP:NHOMO 4175 OP:NHOMOORG 713 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2212--1-1----2------2--- ----42123332114------4--1B------544425B813124161322-648115--21215679381755565521421---------------------------11111111111111-----1--4------44111--12232232211-------1--3322--222---222-1341111--264555558755665566233975563237543555553962222222222222222222466579A785676666A83747B433377786665AA999888999986666566666666788BA88888135575645455232244423332122132331AA-4132-1111111171--111163344--J67121111112364336456P-22E22C27BG-3hSSPRUQRReJNK8---24J4335-4A1111111133411-25----------111111111111111--1-4--1--4EC9EKKKJMIB8AAACCITBABB8BDDX7774-297C7575488EFIO234----844422222---24--1H-897C56BAAA42-23-3----------5-3341555553242222222-13----88A-3-----D-1111--11111111-11-3---1--------99JJ7BB99999A7A98-89B99999998A989988AHNFKI776A8A7AAAAAAAAAA8AG98899893-CBBBBBAABBBB--5-222221111--68A55543533323333255555-64554-FDDFGOHQ9EGBD5IGI----------6668888889987711---------------2----------------3416----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 17.0 SQ:SECSTR ########################################################################################################################ccTTTTTHHHHHTccTHHHHHHTTHHHH####HHHHHHHHHH############################################################## PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //