[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : osmC
DDBJ      :osmC         OsmC-like protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  98/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.227.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->160 2oplB PDBj 5e-13 31.8 %
:RPS:PDB   27->162 3eerA PDBj 3e-22 15.7 %
:RPS:SCOP  27->162 1lqlA  d.227.1.1 * 5e-24 22.5 %
:HMM:SCOP  23->170 1lqlA_ d.227.1.1 * 6.3e-30 31.2 %
:RPS:PFM   57->162 PF02566 * OsmC 3e-11 40.9 %
:HMM:PFM   58->162 PF02566 * OsmC 6.5e-26 39.6 96/99  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21976.1 GT:GENE osmC GT:PRODUCT OsmC-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1125607..1126158) GB:FROM 1125607 GB:TO 1126158 GB:DIRECTION - GB:GENE osmC GB:PRODUCT OsmC-like protein GB:PROTEIN_ID AAZ21976.1 GB:DB_XREF GI:71062973 GB:GENE:GENE osmC LENGTH 183 SQ:AASEQ MSNNLKETISNLQKDFTANPKNAVVQYESNSILKEGLQSVVTLREHKLVVDEPKSFGGKDEGPSPVELILAALATCQEITYKAFATAAGINIESVSVKLKGELDLQGFLALNKNTRPGFQSISGTVDIKSSSPKAEIDKLIDTVNTHCPVLDILSKGVPIKLFQKVSSNSYNEEHIEQRVSAA GT:EXON 1|1-183:0| BL:PDB:NREP 1 BL:PDB:REP 50->160|2oplB|5e-13|31.8|110/178| RP:PDB:NREP 1 RP:PDB:REP 27->162|3eerA|3e-22|15.7|127/138| RP:PFM:NREP 1 RP:PFM:REP 57->162|PF02566|3e-11|40.9|93/99|OsmC| HM:PFM:NREP 1 HM:PFM:REP 58->162|PF02566|6.5e-26|39.6|96/99|OsmC| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02566|IPR003718| RP:SCP:NREP 1 RP:SCP:REP 27->162|1lqlA|5e-24|22.5|129/141|d.227.1.1| HM:SCP:REP 23->170|1lqlA_|6.3e-30|31.2|141/141|d.227.1.1|1/1|OsmC-like| OP:NHOMO 130 OP:NHOMOORG 109 OP:PATTERN -----------------1----------------------------1--------1-1-11------- ---12---------111-------1------11---1152-1---------------------------------------11--------------------------------------------------------------11--2--------------------------------------11----------------------------11----1------1-------------------------------------------------------------------------------------------------------------------1-----------1--1--1111-1---1-----------12231111-11-------------1111112-1---1--------------------1-------------1------------------------------------11----1----213-12-------1------------------------1---1---1--1----------11------------------------1-1--21----3---1-----------------------------------------1------11--1--1-1-1------------------------------------------------111--------------------------------------------------1--------------------111111-------------------11---------------------1------------------------------------1----------------------------1----1------ ----------------2----------------------------------1----------------------------------------2----------------1-------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 74.3 SQ:SECSTR ##########################ccccEEEccTTcEEEEETTcccEEEcccGGTcccccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccEEEEEEEEEccTTTcccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHcHHHHHHTTTcccEE##################### DISOP:02AL 1-3, 181-183| PSIPRED cHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEcccEEEEEEEccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHccccHHHHHccccEEEEEEEEEcccccHHHHHHHHccc //