[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : paaD
DDBJ      :paaD         possible phenylacetic acid degradation protein
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  374/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:98 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->89 1uwdA PDBj 6e-17 32.6 %
:RPS:PDB   3->96 3cq1A PDBj 2e-25 40.9 %
:RPS:SCOP  3->92 2cu6A1  d.52.8.2 * 6e-23 41.1 %
:HMM:SCOP  1->98 1uwdA_ d.52.8.2 * 1.8e-27 35.7 %
:RPS:PFM   4->77 PF01883 * DUF59 6e-12 36.5 %
:HMM:PFM   4->75 PF01883 * DUF59 4.5e-25 37.5 72/76  
:BLT:SWISS 3->98 YITW_BACSU 3e-16 35.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21563.1 GT:GENE paaD GT:PRODUCT possible phenylacetic acid degradation protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 728096..728392 GB:FROM 728096 GB:TO 728392 GB:DIRECTION + GB:GENE paaD GB:PRODUCT possible phenylacetic acid degradation protein GB:PROTEIN_ID AAZ21563.1 GB:DB_XREF GI:71062560 GB:GENE:GENE paaD LENGTH 98 SQ:AASEQ MDLREQVIAEIRKIYDPEIPVNIYELGLIYDVKVNESKAKIIMTLTTPNCPVAESLPQEVKDSAMQVEGIEEVDLDLVFEPPWEKSMMSEAAKLELNL GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 3->98|YITW_BACSU|3e-16|35.4|96/102| BL:PDB:NREP 1 BL:PDB:REP 4->89|1uwdA|6e-17|32.6|86/102| RP:PDB:NREP 1 RP:PDB:REP 3->96|3cq1A|2e-25|40.9|93/98| RP:PFM:NREP 1 RP:PFM:REP 4->77|PF01883|6e-12|36.5|74/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 4->75|PF01883|4.5e-25|37.5|72/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 3->92|2cu6A1|6e-23|41.1|90/91|d.52.8.2| HM:SCP:REP 1->98|1uwdA_|1.8e-27|35.7|98/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 519 OP:NHOMOORG 415 OP:PATTERN 11111112322323321112111-1------------------11-----22--11111111111-11 -11--1111111111------1--1------1----1---1-----------------11---1-1----1----111----3-11121111111111111111111211--------------------------11111---111-111-1-1--------1-121111------------11112---1-1---------------111111---12211--111111--1111111111111111111113--11-213333221111-12-11111111112222222222222211111111111112222222221----------------------------2----------------1-1--1-1111111111111223221111122222222222-1111111121111111212111222211111111111111111111111111-11-----------------------------111111------------2222----122222-----2---------11--2--------2-------------1-1------------------------22121---1111----------------1--21-----111-1--1---------------------1211----------------------------------------------------------------------------------------------11111111111111--------------------------1-----------------111111111---------------11111111111111----111111------------------------------------1111111111121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 96.9 SQ:SECSTR #cHHHHHHHHHTTcccTTTcccTTTTTcEEEEEEETTEEEEEEcccccccccccHHHHHHHHHHHTcTTccEEEEEEcccccccGGGcccGGGTTT## PSIPRED cccHHHHHHHHHHcccccccccEEEcccEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHccHHHHHHHcc //