[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : panB
DDBJ      :panB         3-methyl-2-oxobutanoate hydroxymethyltransferase
Swiss-Prot:PANB_PELUB   RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase;         EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase;         Short=KPHMT;

Homologs  Archaea  38/68 : Bacteria  696/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->257 3ez4H PDBj 2e-30 33.5 %
:RPS:PDB   57->257 3e5bC PDBj 1e-15 12.4 %
:RPS:SCOP  57->257 1m3uA  c.1.12.8 * 2e-31 33.0 %
:HMM:SCOP  2->256 1o66A_ c.1.12.8 * 9.8e-78 44.7 %
:RPS:PFM   51->253 PF02548 * Pantoate_transf 2e-47 45.3 %
:HMM:PFM   4->253 PF02548 * Pantoate_transf 1.7e-90 45.2 250/261  
:BLT:SWISS 19->257 PANB_PELUB e-124 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21473.1 GT:GENE panB GT:PRODUCT 3-methyl-2-oxobutanoate hydroxymethyltransferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 639028..639801 GB:FROM 639028 GB:TO 639801 GB:DIRECTION + GB:GENE panB GB:PRODUCT 3-methyl-2-oxobutanoate hydroxymethyltransferase GB:PROTEIN_ID AAZ21473.1 GB:DB_XREF GI:71062470 GB:GENE:GENE panB LENGTH 257 SQ:AASEQ MNKKILNFIKKKNKTKIISLTAYSKNIASIIDRHCDLVLVGDSLGSVLYSFSSTKKVTLDMMIEHSKSVRMGVKKSLMVVDMPHNTYRNSKEALSNAKKIISKTKCDAIKLEGGKKVIQIIKTLIKNKIPVMGHLGVLPQSATNFKFKGKEIAERKIILRDSKLLEDAGVFSIVLECVESSLAKEITKTVKVPTIGIGASVHCDGQVLVTDDLIGLNKIKARFVKRYSNIEKQINDAALKFKKDVIRSKFPTKKHSY GT:EXON 1|1-257:0| SW:ID PANB_PELUB SW:DE RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase; EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase; Short=KPHMT; SW:GN Name=panB; OrderedLocusNames=SAR11_0653; SW:KW Complete proteome; Cytoplasm; Magnesium; Metal-binding;Methyltransferase; Pantothenate biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 19->257|PANB_PELUB|e-124|100.0|239/257| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 2->18|nkkilnfikkknktkii| SEG 36->48|dlvlvgdslgsvl| BL:PDB:NREP 1 BL:PDB:REP 20->257|3ez4H|2e-30|33.5|224/245| RP:PDB:NREP 1 RP:PDB:REP 57->257|3e5bC|1e-15|12.4|185/398| RP:PFM:NREP 1 RP:PFM:REP 51->253|PF02548|2e-47|45.3|203/261|Pantoate_transf| HM:PFM:NREP 1 HM:PFM:REP 4->253|PF02548|1.7e-90|45.2|250/261|Pantoate_transf| GO:PFM:NREP 2 GO:PFM GO:0003864|"GO:3-methyl-2-oxobutanoate hydroxymethyltransferase activity"|PF02548|IPR003700| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02548|IPR003700| RP:SCP:NREP 1 RP:SCP:REP 57->257|1m3uA|2e-31|33.0|200/262|c.1.12.8| HM:SCP:REP 2->256|1o66A_|9.8e-78|44.7|253/0|c.1.12.8|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 927 OP:NHOMOORG 856 OP:PATTERN 1111111111111111-111111-1111-111----------------------1111111-----11 11-1111111111111111-111111111111111111111111111-111111111111111-1111111---------1--1111111111111---11121111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------11-111111111-1111111-----1----111111211--1111-11---11111111111113-11111111111111111111-11111211121-211122222222111111-1111111111111111111-111111---------------------------111112-111121222211111111111111121111111111122111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111112222111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111211---------------1111111111212222221111211111111111111111211111111111111111111111111111-111111------------------------------------11-1111111111 ----111-----22111111111212111111111111111111111111111111111111111111-1111111111111111111-12112111111111111-111---------------------------------------------------------------1-1111I1111111-31331111122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 92.6 SQ:SECSTR ###################EccccHHHHHHHHHEEcHHHHHHHccTTcccccccccccTTHHHHHHHHHHHHHHHHHHHHHHHTcccHcccccccccccEEccEEEEcTTccccHHHHHHHHHHHHHTccEEEEEcccccEcccccccHHHHHHHHHHHHHHHHHHHHTcccEEEEEEcTTTccEEcccccGGGccTTccccTTccEEccccHHHHHHHGGGccEEEEccccccHHHHHHHHHHHHHHcTTccEEEE DISOP:02AL 1-2, 252-257| PSIPRED cccHHHHHHHHHccccEEEEEEccHHHHHHHHccccEEEEccHHHcEEccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHccccEEEEccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //