[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : panC
DDBJ      :panC         pantoate-beta-alanine ligase
Swiss-Prot:PANC_PELUB   RecName: Full=Pantothenate synthetase;         Short=PS;         EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme;

Homologs  Archaea  0/68 : Bacteria  699/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:280 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   25->279 2ejcA PDBj 8e-30 27.8 %
:RPS:PDB   10->280 2a88A PDBj 7e-39 25.8 %
:RPS:SCOP  11->182 1ihoA  c.26.1.4 * 1e-17 32.0 %
:HMM:SCOP  11->282 1ihoA_ c.26.1.4 * 1.9e-66 31.7 %
:RPS:PFM   28->182 PF02569 * Pantoate_ligase 2e-30 36.6 %
:HMM:PFM   12->279 PF02569 * Pantoate_ligase 4.5e-71 32.5 268/280  
:BLT:SWISS 1->280 PANC_PELUB e-138 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21892.1 GT:GENE panC GT:PRODUCT pantoate-beta-alanine ligase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1054401..1055243 GB:FROM 1054401 GB:TO 1055243 GB:DIRECTION + GB:GENE panC GB:PRODUCT pantoate-beta-alanine ligase GB:PROTEIN_ID AAZ21892.1 GB:DB_XREF GI:71062889 GB:GENE:GENE panC LENGTH 280 SQ:AASEQ MFYLLIFLLQMKLIKLKTDLIKAIELDRRLGFVPTMGSLHEGHKTLIKTSQKNCKKTLVSIFINPTQFNNKKDYKTYPKNLKQDLSYLKKLKVDYVYLPTIKQIYWKKNNEIKLNKSQKILCAKFRKGHFEGVLNVLDRFIELISPQKMFMGEKDFQQFFLVKNYIENKYNTKVHVCKTVREKNKLALSSRNSLLNKKSFINSGIIAKKLLSLKNEIKKNKKNYKKMIFYLKEELSKNFDIKIEYLECRNTHNLSTNIMNKPFKLFVAYYINNVRLIDNF GT:EXON 1|1-280:0| SW:ID PANC_PELUB SW:DE RecName: Full=Pantothenate synthetase; Short=PS; EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme; SW:GN Name=panC; OrderedLocusNames=SAR11_1088; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Pantothenate biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->280|PANC_PELUB|e-138|100.0|280/280| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| TM:NTM 1 TM:REGION 1->23| SEG 183->199|knklalssrnsllnkks| SEG 208->226|kkllslkneikknkknykk| BL:PDB:NREP 1 BL:PDB:REP 25->279|2ejcA|8e-30|27.8|255/280| RP:PDB:NREP 1 RP:PDB:REP 10->280|2a88A|7e-39|25.8|256/276| RP:PFM:NREP 1 RP:PFM:REP 28->182|PF02569|2e-30|36.6|153/279|Pantoate_ligase| HM:PFM:NREP 1 HM:PFM:REP 12->279|PF02569|4.5e-71|32.5|268/280|Pantoate_ligase| GO:PFM:NREP 2 GO:PFM GO:0004592|"GO:pantoate-beta-alanine ligase activity"|PF02569|IPR003721| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02569|IPR003721| RP:SCP:NREP 1 RP:SCP:REP 11->182|1ihoA|1e-17|32.0|172/282|c.26.1.4| HM:SCP:REP 11->282|1ihoA_|1.9e-66|31.7|271/282|c.26.1.4|1/1|Nucleotidylyl transferase| OP:NHOMO 840 OP:NHOMOORG 818 OP:PATTERN -------------------------------------------------------------------- 11-1111111111111111-111111111111111111111211-11-111111111111111-1121111---------1-11111111111111---11111111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------1--111111111-1111111-----11---111111211--1111-11---11111111111113111111111111111111111-11111111111-111111111111111111-11111111111111111111111-11---------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111111---------------11111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------11-1111111121 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-1111111111-12-111-111------------------------------------------------------------8----11114112111--21121111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 98.2 SQ:SECSTR #####EEEEccEEEccHHHHHHHHHHTccEEEEEEcccccHHHHHHHHHHHTTTcEEEEEEccccccTTccccGcccccccccHHHHHHHTTccEEEcccHHHHcTTccccccccGGGGcGGGTTcTTHHHHHHHHHHHHHHHHcccEEEEETTcHHHHHHHHHHHHHTcccEEEEEcccccTTcccccGGGGGccHHHHHHTHHHHHHHHHHHHHGGGcHHHHHHHHHHHHHHHHHcTTcEEEEEEEEETTccccccccEEEEEEEEEEETTEEEEEEE PSIPRED cHHHHHHHHHHHEEccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHccEEEEEEEccHHHcccccHHHHccccHHHHHHHHHHccccEEEcccHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEcHHHcccccccccEEEEEEEEEccEEEcccc //