[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : parB
DDBJ      :parB         chromosome partitioning protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  730/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.268.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->213 1vz0H PDBj 6e-36 42.1 %
:RPS:PDB   20->121 3cyiA PDBj 4e-20 21.2 %
:RPS:PDB   130->195 2auwB PDBj 9e-09 13.6 %
:RPS:SCOP  25->223 1vk1A  d.268.1.2 * 3e-44 19.2 %
:HMM:SCOP  25->182 1vk1A_ d.268.1.2 * 1.9e-38 34.2 %
:RPS:PFM   38->116 PF02195 * ParBc 8e-15 46.1 %
:RPS:PFM   140->186 PF08535 * KorB 9e-06 48.9 %
:HMM:PFM   29->120 PF02195 * ParBc 3.8e-27 40.4 89/90  
:HMM:PFM   143->181 PF08535 * KorB 9.1e-06 28.2 39/93  
:BLT:SWISS 7->279 PARB_PSEPU 5e-51 40.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21176.1 GT:GENE parB GT:PRODUCT chromosome partitioning protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 346398..347246 GB:FROM 346398 GB:TO 347246 GB:DIRECTION + GB:GENE parB GB:PRODUCT chromosome partitioning protein GB:PROTEIN_ID AAZ21176.1 GB:DB_XREF GI:71062173 GB:GENE:GENE parB LENGTH 282 SQ:AASEQ MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVRRSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEEFSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVRQSENFVKIFKTKKHSLKTSKDINLQVLENSIREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKSNY GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 7->279|PARB_PSEPU|5e-51|40.2|271/290| BL:PDB:NREP 1 BL:PDB:REP 27->213|1vz0H|6e-36|42.1|183/187| RP:PDB:NREP 2 RP:PDB:REP 20->121|3cyiA|4e-20|21.2|99/107| RP:PDB:REP 130->195|2auwB|9e-09|13.6|66/151| RP:PFM:NREP 2 RP:PFM:REP 38->116|PF02195|8e-15|46.1|76/89|ParBc| RP:PFM:REP 140->186|PF08535|9e-06|48.9|47/84|KorB| HM:PFM:NREP 2 HM:PFM:REP 29->120|PF02195|3.8e-27|40.4|89/90|ParBc| HM:PFM:REP 143->181|PF08535|9.1e-06|28.2|39/93|KorB| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF02195|IPR003115| RP:SCP:NREP 1 RP:SCP:REP 25->223|1vk1A|3e-44|19.2|198/232|d.268.1.2| HM:SCP:REP 25->182|1vk1A_|1.9e-38|34.2|158/232|d.268.1.2|1/1|ParB/Sulfiredoxin| OP:NHOMO 1045 OP:NHOMOORG 736 OP:PATTERN -------------1----------------------------------------------------11 3311111111111111112-111111111111111121111111111111112211111111111111211111121111111--1--2312-1111--111111111111111111111111111111111111122223---224231-------------1--1231-------------45322111222222222222222222222222222222222222222223222222222222222222221222222222222222222111111111111111111111111111111111111131111111111111223222222222224222221111221111511112212321122221--111111111111-11121111111111111111112-221111121121311222121111111112111211111222222221111112111-11111111111111121111111-11113511111114222222222233122222122431233114312124215221111111121111111111213131221-1111111111112111212131111-1111111111111111111111111123121121111111111111111111111111--12111---------------------------------------------1----------------1---------------111-11-11-----133313232212111---------------1121211111111111111311111121111111111112111111111111111211111112223--114433431111111121------------------------------------211 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 68.8 SQ:SECSTR ###################cccccEEEEEEEGGGEEccccccccHccHHHHHHHHHHHHHcGGGcccEEEEEETccEEEEccccHHHHHHHHHTTccEEEEEEEEEcHHHHHHGGGccccccTTccHHHcccHHHHHHHHTTccHHHHHHHHTccHHHHHHHTTcccccHHHHHHHHHHHHHcccccccccccccGHHHHHHHHTTccHHHHH##################################################################### DISOP:02AL 1-12, 14-15, 213-240| PSIPRED ccccccccHHcccHHHHccccccccccEEEcHHHHccccccccccccHHHHHHHHHHHHHccccccEEEEEccccccEEEEEcccHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccEEEEEccccEEEEEEEEccHHHHHHHHHHHHccc //