[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pdxJ
DDBJ      :pdxJ         pyridoxal phosphate biosynthetic protein PdxJ
Swiss-Prot:PDXJ_PELUB   RecName: Full=Pyridoxine 5'-phosphate synthase;         Short=PNP synthase;         EC=2.6.99.2;

Homologs  Archaea  0/68 : Bacteria  509/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.24
:239 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->236 1m5wA PDBj 7e-48 40.9 %
:RPS:SCOP  3->236 1ho1A  c.1.24.1 * 4e-62 39.4 %
:HMM:SCOP  1->241 1ho1A_ c.1.24.1 * 1.4e-75 42.9 %
:RPS:PFM   4->236 PF03740 * PdxJ 2e-49 41.6 %
:HMM:PFM   3->237 PF03740 * PdxJ 4.6e-85 46.0 235/239  
:BLT:SWISS 1->239 PDXJ_PELUB e-121 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21862.1 GT:GENE pdxJ GT:PRODUCT pyridoxal phosphate biosynthetic protein PdxJ GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1024634..1025353) GB:FROM 1024634 GB:TO 1025353 GB:DIRECTION - GB:GENE pdxJ GB:PRODUCT pyridoxal phosphate biosynthetic protein PdxJ GB:PROTEIN_ID AAZ21862.1 GB:DB_XREF GI:71062859 GB:GENE:GENE pdxJ LENGTH 239 SQ:AASEQ MKRLGVNIDHVATVRNARGSFHPDPFTIAKHVIKCGAHSVTIHLREDRRHIKDSDVVKICKSRKIITNLEISLNKEIIDIALKNRPNFICIVPEKRKEVTTEGGLNLIKNKKKIKSIISLFNKKSIRTSLFIDPNLKDIKIAKELNATCVELHTGKISNLIKENKSYKNEYLKIKKCSELGVKLGIEVHAGHGLDYKTTSILSKIKEITEFNIGHFIIGESLTHGLKKTITIFKEITNK GT:EXON 1|1-239:0| SW:ID PDXJ_PELUB SW:DE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase; EC=2.6.99.2; SW:GN Name=pdxJ; OrderedLocusNames=SAR11_1056; SW:KW Complete proteome; Cytoplasm; Pyridoxine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->239|PDXJ_PELUB|e-121|100.0|239/239| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008615|"GO:pyridoxine biosynthetic process"|Pyridoxine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 105->126|lnliknkkkiksiislfnkksi| BL:PDB:NREP 1 BL:PDB:REP 4->236|1m5wA|7e-48|40.9|232/242| RP:PFM:NREP 1 RP:PFM:REP 4->236|PF03740|2e-49|41.6|233/237|PdxJ| HM:PFM:NREP 1 HM:PFM:REP 3->237|PF03740|4.6e-85|46.0|235/239|PdxJ| GO:PFM:NREP 2 GO:PFM GO:0005737|"GO:cytoplasm"|PF03740|IPR004569| GO:PFM GO:0008615|"GO:pyridoxine biosynthetic process"|PF03740|IPR004569| RP:SCP:NREP 1 RP:SCP:REP 3->236|1ho1A|4e-62|39.4|226/235|c.1.24.1| HM:SCP:REP 1->241|1ho1A_|1.4e-75|42.9|240/0|c.1.24.1|1/1|Pyridoxine 5'-phosphate synthase| OP:NHOMO 514 OP:NHOMOORG 511 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------111111111-111---11111111111---------------11111111111----------1111111111111111111111111111111111111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1-11111111111111112111111111111111111111111-11111111111-1-11111211111111111111111111111-1-11111-111111111111111111--1111111111111111111111111111111111111111111111111111111--1111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------11111111111111111111111111111---------11111111111111111111111111111111-111111----------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 97.5 SQ:SECSTR ###EEEEcHHHHHHHHTcccccccHHHHHHHHHTTTccEEEEEccTTcccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccEEEEccccccccccccccccGGGHHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHTTccEEEEEcHHHHHccccHHHHHHHHHHHHHHHHHHHHTTcEEEEEccccTTTHHHHHTcTTEEEEEEcHHHHHHHHHHcHHHHHHHHHHH### PSIPRED ccccccccHHHHHHHHccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHccccEEccccccHHHHHHHHHccccEEEEEEccHHHccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcc //