[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pepP
DDBJ      :pepP         Xaa-Pro aminopeptidase
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  645/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
b.19.1c.55.2d.127.1
:564 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->558 3ctzA PDBj 8e-74 33.1 %
:RPS:PDB   16->561 3ctzA PDBj 1e-61 30.0 %
:RPS:SCOP  15->104 1pv9A1  c.55.2.1 * 3e-10 18.8 %
:RPS:SCOP  174->212 1flcA1  b.19.1.3 * 5e-06 5.1 %
:RPS:SCOP  282->524 1c21A  d.127.1.1 * 1e-42 17.1 %
:HMM:SCOP  9->92 1pv9A1 c.55.2.1 * 2e-12 35.1 %
:HMM:SCOP  160->284 1pv9A1 c.55.2.1 * 0.00039 21.9 %
:HMM:SCOP  286->534 2bwvA2 d.127.1.1 * 3.7e-50 34.8 %
:RPS:PFM   37->107 PF01321 * Creatinase_N 2e-05 33.3 %
:RPS:PFM   341->500 PF00557 * Peptidase_M24 3e-20 35.9 %
:HMM:PFM   292->502 PF00557 * Peptidase_M24 1.4e-41 29.8 198/203  
:HMM:PFM   6->124 PF01321 * Creatinase_N 9.6e-17 23.1 108/131  
:HMM:PFM   156->215 PF01321 * Creatinase_N 0.00017 14.8 54/131  
:BLT:SWISS 17->564 XPP1_DICDI 1e-85 37.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20840.1 GT:GENE pepP GT:PRODUCT Xaa-Pro aminopeptidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 15862..17556 GB:FROM 15862 GB:TO 17556 GB:DIRECTION + GB:GENE pepP GB:PRODUCT Xaa-Pro aminopeptidase GB:PROTEIN_ID AAZ20840.1 GB:DB_XREF GI:71061837 GB:GENE:GENE pepP LENGTH 564 SQ:AASEQ MILKKIKILRKKFKQYNIDGYIIPKNDEYFSEYAKNDRLKNITGFSGSAGFTVVLKKQNYLFVDGRYTIQAHQQSSKNFKIIEIHKKLPHTIIKNFNLGYDPTLFTSKLLNKYFKNNNLISIDQNLIDQIFKFKEKPTKPFYSLDTKIAGEPYSYKISKVVRFLKKNKADYCFISAPENVAWLLNIRGYDNPNSPIANARLILNKKKEFFLIANEKKLKNLLLDKKIKKKQILPIKSLPQFLDNLKGKNFIIDNKTCSIFYEKIIKSNFNILKFDDPVYELKSMKNSNEIKHMIEAHKKDGLALTKFIYWIKNVNKKKITEVYAQNKLEKFRKLNKDYLFPSFDTIAGAGSNGAIVHYRANKKTTKKIEQNDILLVDSGGQYHYGTTDVTRTISFSKQNKFIKNAYTNVLKGHIAVALTNLNKDDTGKKIDIRARKYLKKEGQDYAHGTGHGVGFFLNVHEGPQSISKHNSIKIKNGMILSNEPGFYKKNHFGIRIENLIYAKKTKRSFNFENLTLAPLEKDLINYELLNKIEKDYLFKYHLNIYSEFSSLLNKKERKWLATLI GT:EXON 1|1-564:0| BL:SWS:NREP 1 BL:SWS:REP 17->564|XPP1_DICDI|1e-85|37.3|544/627| SEG 2->14|ilkkikilrkkfk| SEG 108->119|kllnkyfknnnl| SEG 216->238|kklknllldkkikkkqilpiksl| BL:PDB:NREP 1 BL:PDB:REP 18->558|3ctzA|8e-74|33.1|540/617| RP:PDB:NREP 1 RP:PDB:REP 16->561|3ctzA|1e-61|30.0|543/617| RP:PFM:NREP 2 RP:PFM:REP 37->107|PF01321|2e-05|33.3|69/130|Creatinase_N| RP:PFM:REP 341->500|PF00557|3e-20|35.9|153/203|Peptidase_M24| HM:PFM:NREP 3 HM:PFM:REP 292->502|PF00557|1.4e-41|29.8|198/203|Peptidase_M24| HM:PFM:REP 6->124|PF01321|9.6e-17|23.1|108/131|Creatinase_N| HM:PFM:REP 156->215|PF01321|0.00017|14.8|54/131|Creatinase_N| GO:PFM:NREP 2 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01321|IPR000587| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 3 RP:SCP:REP 15->104|1pv9A1|3e-10|18.8|80/116|c.55.2.1| RP:SCP:REP 174->212|1flcA1|5e-06|5.1|39/156|b.19.1.3| RP:SCP:REP 282->524|1c21A|1e-42|17.1|234/263|d.127.1.1| HM:SCP:REP 9->92|1pv9A1|2e-12|35.1|74/0|c.55.2.1|1/2|Creatinase/prolidase N-terminal domain| HM:SCP:REP 160->284|1pv9A1|0.00039|21.9|114/0|c.55.2.1|2/2|Creatinase/prolidase N-terminal domain| HM:SCP:REP 286->534|2bwvA2|3.7e-50|34.8|233/0|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 1355 OP:NHOMOORG 880 OP:PATTERN ---1-12222222222121222--------1-11-11-11111-----------21222231112-11 111--1212222212--11-11111-1111112212-1-------------1------------1----1--------1-2--111111111-111---111-1----111111111111----1--11--11-112221111122------111----------11---11---111-1--1-1-111121224444444424444441222224442114222222222422222222222222222222222212212222112222121222222112212212222222222222121111212111112111122221212344444542421511333311-11112-111111111111111111111111211111111111111111111111111111-11111111111111111111111111112121111112111111111111111111111111111111111111111111111111112111111111111111111111222222111---------11----------------1-1111111--------111--------111-1------------1-11111111111111111111-1111--1113--2-2211111112111111111111-------------2----1-1111111111-1112122211112111111-1----11-1---------------111-----1----------------111111111--11-----1---------111221--111-1111-1111-1111-111111111111-11111111112111---------------1-2------11111111111-1--1-11111111111111111111121111111--- 1111121-421-1111221111111112211111111211-11111321211111111112211211112112221111112222212-23322252222212436114252322352222122522426L2-3222212322321222222142132126113243345B32322111J2111123471341111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 546 STR:RPRED 96.8 SQ:SECSTR ###############ccccEEEEccccTTccccccGcHHHHHHcccccccEEEEEcccEEEEEcGGGHHHHHHHccTTEEEEEEETTcTTcccTTcEEEEcGGGccHHHHHHHHTTcEEEEccccHHHHHcTTccccccccEEccHHHHcccHHHHHHHHHHHHHTTTEEEEEEccHHHHHHHHTEEccccccccccccEEEEcccEEEEcccGGGGcHHHHHHTTTTccccGGGcEEEEcGGGHHHcTTcEEEEETTccHHHHHHGGGEEEEcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGTcccHHHHHHHHHHHHHTcTTEEEEccccEEEEGGGGGcTTccccGGGcccccTTccEEEEEcEEETTEEccEEEEEccccccHHHHHHHHHHHHHHHHHHHTccEETTccGGGGGGGGTHHHHHTcccccccEEccccccccccccEcTTccccccccTTcEEEEccEEEETTTEEEEccEEEEEEccccEEEEEEcccccccGGGccGGGccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHH### DISOP:02AL 1-3, 139-140| PSIPRED ccHHHHHHHHHHHHHccccEEEEccccHHccccccccccEEEEccccccEEEEEEccccEEEEccHHHHHHHHHccccEEEEEEHHHHHHHHccccEEEEccEEEcHHHHHHHHHcccEEEEcccHHHHHHccccccccccEEcccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHccccccccccccEEEEEEEEcccccEEEEEccccHHHHHHHHHccccccccHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccEEEccccccccccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEcEEEEEEcccEEEccccEEEEEEEEEEEccccccccEEEEcccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcc //