[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : petA
DDBJ      :petA         cytochrome b6-f complex iron-sulfur subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  316/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
b.33.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->166 3cx5E PDBj 6e-52 60.0 %
:RPS:PDB   29->169 3cwbE PDBj 2e-30 48.9 %
:RPS:SCOP  41->159 1ezvE1  b.33.1.1 * 3e-24 64.7 %
:HMM:SCOP  28->168 1jm1A_ b.33.1.1 * 4.2e-44 41.7 %
:RPS:PFM   79->150 PF00355 * Rieske 2e-06 46.5 %
:HMM:PFM   3->38 PF10399 * UCR_Fe-S_N 1.1e-21 61.1 36/41  
:HMM:PFM   75->159 PF00355 * Rieske 8.4e-21 31.0 84/97  
:BLT:SWISS 5->169 UCRI_RICBR 3e-55 54.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20924.1 GT:GENE petA GT:PRODUCT cytochrome b6-f complex iron-sulfur subunit GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(112514..113023) GB:FROM 112514 GB:TO 113023 GB:DIRECTION - GB:GENE petA GB:PRODUCT cytochrome b6-f complex iron-sulfur subunit GB:PROTEIN_ID AAZ20924.1 GB:DB_XREF GI:71061921 GB:GENE:GENE petA LENGTH 169 SQ:AASEQ MSEKKPERREFLFTASYAVGAVGVGAVVWPLVDQMNPDASVKALASTEVDVSSVQPGKTITVLWRGKPVFIKRRTPEEVAEARAVKMEDLKDPQKDEDRAKDPEWLVMLGVCTHLGCVPLNDKGDYNGWFCPCHGSHYDISGRIRKGPAPTNMEVPKYEFVNSNTIKIG GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 5->169|UCRI_RICBR|3e-55|54.5|165/186| TM:NTM 1 TM:REGION 12->34| SEG 18->28|avgavgvgavv| BL:PDB:NREP 1 BL:PDB:REP 32->166|3cx5E|6e-52|60.0|135/185| RP:PDB:NREP 1 RP:PDB:REP 29->169|3cwbE|2e-30|48.9|141/196| RP:PFM:NREP 1 RP:PFM:REP 79->150|PF00355|2e-06|46.5|71/95|Rieske| HM:PFM:NREP 2 HM:PFM:REP 3->38|PF10399|1.1e-21|61.1|36/41|UCR_Fe-S_N| HM:PFM:REP 75->159|PF00355|8.4e-21|31.0|84/97|Rieske| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 41->159|1ezvE1|3e-24|64.7|119/129|b.33.1.1| HM:SCP:REP 28->168|1jm1A_|4.2e-44|41.7|139/202|b.33.1.1|1/1|ISP domain| OP:NHOMO 591 OP:NHOMOORG 501 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------12111---------------------------------------------------------------------1-1-1-----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--1111122112322311111111111111111111121-11111131111111112111111111111111111-111-1221211111111111111111111111111111111111111111111111111121111111111111111121221221121111131-11111111111111121--------------------------------1111111111111111111111-112211-111111111111111111111111111---1111------1-------------------------------------------------------------------------------------2-----1111111------------------------1111111111111111111------------11111111111111111111111111111111-------------------------------------------------------- 11--111-211-1121111111111111111111111111111111111111111111111111111111111111111111111111-12111111111111223-1413323121-111-1111121182-212-1-2111-11-1-111111111122111122212211121111D2111142221211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 99.4 SQ:SECSTR #TTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccGGGccTTcEEEccccccccEEEEccHHHHTTTTcccTTcccccccTTcccccTTEEEEccccTTTccccEEcccccccEEETTTTEEEcTTccEEEcccccccccccEEEcccccEEEc DISOP:02AL 1-5, 8-9| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccEEEccccccccEEEEEEcccEEEEEEccHHHHHHHHHcccccEEccccccHHcccccEEEEEEEcccccccccccccccccEEccccccEEcccccEEcccccccccccEEEEccccEEEEc //