[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : petB
DDBJ      :petB         ubiquinol-cytochrome-c reductase
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  474/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
f.21.1f.32.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->400 1zrtC PDBj e-133 57.4 %
:RPS:PDB   19->335 1bccC PDBj 5e-55 31.7 %
:RPS:SCOP  19->276 1bccC3  f.21.1.2 * 1e-72 54.2 %
:RPS:SCOP  277->392 1bccC2  f.32.1.1 * 2e-24 37.9 %
:HMM:SCOP  13->276 1ezvC3 f.21.1.2 * 7.6e-109 54.4 %
:HMM:SCOP  206->367 1q90D_ f.32.1.1 * 2.6e-54 51.6 %
:RPS:PFM   32->220 PF00033 * Cytochrom_B_N 3e-41 56.2 %
:RPS:PFM   275->375 PF00032 * Cytochrom_B_C 3e-17 44.6 %
:HMM:PFM   274->375 PF00032 * Cytochrom_B_C 1.4e-42 56.9 102/102  
:HMM:PFM   31->213 PF00033 * Cytochrom_B_N 1.8e-16 22.2 144/188  
:BLT:SWISS 1->403 CYB_RHOVI e-146 62.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20923.1 GT:GENE petB GT:PRODUCT ubiquinol-cytochrome-c reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(111245..112504) GB:FROM 111245 GB:TO 112504 GB:DIRECTION - GB:GENE petB GB:PRODUCT ubiquinol-cytochrome-c reductase GB:PROTEIN_ID AAZ20923.1 GB:DB_XREF GI:71061920 GB:GENE:GENE petB LENGTH 419 SQ:AASEQ MSDHEYVPSSKFGKWFNDRLPLLSLASHLTDYPTPKNLNYWWTFGGILTFCLITQIVTGLTLAMHYIAHADMAFESVEHIMRDVNYGWLIRYIHANGASMFFLAVYIHIFRSLFYGSYKSPREIIWIIGIIIYLLMMAAAFMGYVLPWGQMSFWGATVITNLFSAIPLVGEGIVNWLWGGYSVDNPTLTRFFTLHYLIPFLILGLVVLHIWALHVPGNNNPVGIDVKKPSKDTVPFHPYIVIKDGFALLMFMIVFAFFVFYSPNILGHADNYIEANPMVTPAHIVPEWYLLPFYAILRSVPDKLMGVVAMLSAILILAALPWLDTSKIRSAVFRPLYKQFYWILVVDVLVLGYVGAMPAEGLYLLIARVATAYYFIHFLIILPVLGFKEKTIPLPLSITEPVLGGMPMASAVKKKESLN GT:EXON 1|1-419:0| BL:SWS:NREP 1 BL:SWS:REP 1->403|CYB_RHOVI|e-146|62.7|402/419| TM:NTM 9 TM:REGION 43->65| TM:REGION 94->116| TM:REGION 124->146| TM:REGION 152->174| TM:REGION 193->214| TM:REGION 239->261| TM:REGION 301->323| TM:REGION 334->356| TM:REGION 363->385| SEG 124->132|iiwiigiii| SEG 309->320|amlsaililaal| SEG 344->351|lvvdvlvl| BL:PDB:NREP 1 BL:PDB:REP 3->400|1zrtC|e-133|57.4|397/427| RP:PDB:NREP 1 RP:PDB:REP 19->335|1bccC|5e-55|31.7|312/379| RP:PFM:NREP 2 RP:PFM:REP 32->220|PF00033|3e-41|56.2|169/172|Cytochrom_B_N| RP:PFM:REP 275->375|PF00032|3e-17|44.6|101/102|Cytochrom_B_C| HM:PFM:NREP 2 HM:PFM:REP 274->375|PF00032|1.4e-42|56.9|102/102|Cytochrom_B_C| HM:PFM:REP 31->213|PF00033|1.8e-16|22.2|144/188|Cytochrom_B_N| GO:PFM:NREP 6 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00033|IPR005797| GO:PFM GO:0016020|"GO:membrane"|PF00033|IPR005797| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00033|IPR005797| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00032|IPR005798| GO:PFM GO:0016020|"GO:membrane"|PF00032|IPR005798| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00032|IPR005798| RP:SCP:NREP 2 RP:SCP:REP 19->276|1bccC3|1e-72|54.2|253/260|f.21.1.2| RP:SCP:REP 277->392|1bccC2|2e-24|37.9|116/119|f.32.1.1| HM:SCP:REP 13->276|1ezvC3|7.6e-109|54.4|261/261|f.21.1.2|1/1|Transmembrane di-heme cytochromes| HM:SCP:REP 206->367|1q90D_|2.6e-54|51.6|155/0|f.32.1.1|1/1|a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)| OP:NHOMO 638 OP:NHOMOORG 555 OP:PATTERN ------3233333333-2------2112122------------------------------1221-11 1-4111111111112-------11---------1111-111-1-111111111111111111211111211-----------211111-------------------------------------11111111111--------1-11111111111111111111211211111111111111-111----111111111111111111111111111111111------111---------------------------------------------------------------------------------------------------------------------1--1-11---------------11-1111-1--1111111111111111111111111111111111121-111111111111111111111111111222222221111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111---1-----------222-222--1111-1-11111111111111111111111-112211-111111111111111111111111111---1111------1-------------------------------------------------------------------------------------1-----1111111------------------------1111111111111111111------------11111111111111111111111111111111------------------------------------------------------1- -3------1-----1------------1-------1--------11-1------1-1-----2-211---1-1---4----------1-----1---11-1----1------11111-----1-11-1-12--11-----1--11--------1-1------1--112--A-13-2-3------11117-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 94.7 SQ:SECSTR ##cc#ccccccHHccTTcccTTHHHHTTTcccEEETTccGGGHHHHHHHHHHHHHHHHHHHHHTTccccTTTHHHHHHHHHHTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTGGGcHHHHHHHHHHHHHHHHHHHHHTTTcTTccHHHHHHHHHHHHGGGGcccTTHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTccccTccTTcEEETTTTHHHHHHHHHHHHHHHHHHHHHHcTTTTccGGGGccccTTcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHGGGTGGGcccccccccTTcHHHHHHHHHHHHHHHHHHHHTTccccTTHHHHHHHHHHHHHHHHHTHHHHHHHHHTTccccccccc################### DISOP:02AL 1-10, 403-419| PSIPRED cccccccccccccccHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHcEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHccc //