[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pilO
DDBJ      :pilO         type 4 fimbrial biogenesis protein PilO
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.238.1
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  44->131 2efkA1  a.238.1.4 * 5e-04 23.8 %
:HMM:PFM   19->146 PF02932 * Neur_chan_memb 8e-05 16.9 118/237  
:BLT:SWISS 26->131 ATPF_SPIOL 6e-05 24.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20887.1 GT:GENE pilO GT:PRODUCT type 4 fimbrial biogenesis protein PilO GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(72547..73224) GB:FROM 72547 GB:TO 73224 GB:DIRECTION - GB:GENE pilO GB:PRODUCT type 4 fimbrial biogenesis protein PilO GB:PROTEIN_ID AAZ20887.1 GB:DB_XREF GI:71061884 GB:GENE:GENE pilO LENGTH 225 SQ:AASEQ MDIDLKNINMSDIKDQITKLADKKTLIKIGIIFGAIVFFLIIYYAILNPMVESRKAKLDDMNLKIQETAKFTSEIYSMRARIKKLKPDYEKYSSLFHSKAEVEGLYQTLSEYAGQNDLVITRIEKKVIQEVLKAQALAQADGKKTKKKKNNQVKNVANIAYYLIPVDFEIDGNFIGYIKFKRALSLSNKMLNFDKESIQVVKGNTTGAIKVKGTLTIVGLPNEFF GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 26->131|ATPF_SPIOL|6e-05|24.3|103/184| TM:NTM 1 TM:REGION 28->50| SEG 143->158|kktkkkknnqvknvan| HM:PFM:NREP 1 HM:PFM:REP 19->146|PF02932|8e-05|16.9|118/237|Neur_chan_memb| RP:SCP:NREP 1 RP:SCP:REP 44->131|2efkA1|5e-04|23.8|80/272|a.238.1.4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 137-154| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHEEEEEEEEEEEEcccEEEEEHHHHHHHHHHHHHccccHHEEEEEccccEEEEEEEEEEEEEcccccc //