[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pmpA
DDBJ      :pmpA         peroxisomal membrane protein a (pmp20)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  260/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->158 1tp9D PDBj 1e-30 38.4 %
:RPS:PDB   3->147 2cv4A PDBj 2e-10 17.3 %
:RPS:SCOP  3->159 1h4oA  c.47.1.10 * 2e-42 40.6 %
:HMM:SCOP  1->161 1tp9A1 c.47.1.10 * 6.9e-38 31.9 %
:RPS:PFM   32->111 PF00578 * AhpC-TSA 3e-04 26.3 %
:HMM:PFM   5->154 PF08534 * Redoxin 3.4e-33 35.3 136/146  
:BLT:SWISS 26->158 PRX2C_ORYSJ 2e-31 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20951.1 GT:GENE pmpA GT:PRODUCT peroxisomal membrane protein a (pmp20) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(136092..136577) GB:FROM 136092 GB:TO 136577 GB:DIRECTION - GB:GENE pmpA GB:PRODUCT peroxisomal membrane protein a (pmp20) GB:PROTEIN_ID AAZ20951.1 GB:DB_XREF GI:71061948 GB:GENE:GENE pmpA LENGTH 161 SQ:AASEQ MKLKENDNIPNSEFFIMEDGNPTKKNTHEFYKDKKIVLFGLPGAYTSVCSAKHLPGYVNNYEKYKEKGIDHIVCISVNDPFVMDSWGKSQNVENKIIMMADPFLEFTKAIGADVDKSARGLGIRSNRYTMLIDNLKVIKLQEEEDAGACEISAAQNFLSLV GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 26->158|PRX2C_ORYSJ|2e-31|46.2|132/162| BL:PDB:NREP 1 BL:PDB:REP 7->158|1tp9D|1e-30|38.4|151/160| RP:PDB:NREP 1 RP:PDB:REP 3->147|2cv4A|2e-10|17.3|139/236| RP:PFM:NREP 1 RP:PFM:REP 32->111|PF00578|3e-04|26.3|76/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 5->154|PF08534|3.4e-33|35.3|136/146|Redoxin| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 3->159|1h4oA|2e-42|40.6|155/161|c.47.1.10| HM:SCP:REP 1->161|1tp9A1|6.9e-38|31.9|160/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 620 OP:NHOMOORG 419 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111-------1--11--1111-1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211111111-11111111111111111111111-111111111211122222311122112111122122122--------1---1-11-----------------------------11121-222221111111111111121111111112222111111111112111111-----111111111-----------------------------------1---------------------------1111-2--212221-11111-111111-11-1---121----------11-1------------------------------------------------------1---------111111111111---1---------1212211111111111-111--------11-----------111-----1111111111111122222221111111111111--------------------------------------------------------------- 11--111-1---111232233333333222222222-111111222332222222221221222411122--2331111123234511-2413212---1112332-1213-211121-1--11221111B1-211-1-11-111-11--11-11--11----42312111--121311-1-232648626532----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 98.8 SQ:SECSTR ##ccTTccccccEEEEEETTEEEEETHHHHTTTcEEEEEEccccccHHHHHHHHHHHHHTHHHHHHTTEEEEEEEEcccHHHHHHHHHHHHHHTcccccccEEEcTTcHHHHHTTcccTTccccccEEEEEEcTTccEEEEEEcTccccccccHHHHTHHc DISOP:02AL 161-162| PSIPRED cccccccccccEEEEEEEcccccEEEHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHccccccEEEEEcccHHHHHHcccccccccccccccccEEEEEEEcccEEEEEEEccccccccccHHHHHHHc //