[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pntAB
DDBJ      :pntAB        NAD(P) transhydrogenase subunit alpha part 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  262/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->52 PF11872 * DUF3392 4.3e-05 22.9 48/106  
:HMM:PFM   44->88 PF11297 * DUF3098 0.00022 32.5 40/64  
:BLT:SWISS 20->95 PNTAB_RHORU 9e-17 54.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21396.1 GT:GENE pntAB GT:PRODUCT NAD(P) transhydrogenase subunit alpha part 2 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 566004..566312 GB:FROM 566004 GB:TO 566312 GB:DIRECTION + GB:GENE pntAB GB:PRODUCT NAD(P) transhydrogenase subunit alpha part 2 GB:PROTEIN_ID AAZ21396.1 GB:DB_XREF GI:71062393 GB:GENE:GENE pntAB LENGTH 102 SQ:AASEQ MEIDPFIFRLSIFILSIFIGYYVVWSVTPSLHTPLMSVTNAISSVIIVGAIIAGLAGSTENVFTISNILGFLAISLAAINIFGGFLVTQRMLQMYKKKKKDK GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 20->95|PNTAB_RHORU|9e-17|54.2|72/139| TM:NTM 3 TM:REGION 7->29| TM:REGION 36->58| TM:REGION 67->89| SEG 6->19|fifrlsifilsifi| SEG 41->58|aissviivgaiiaglags| SEG 96->101|kkkkkd| HM:PFM:NREP 2 HM:PFM:REP 5->52|PF11872|4.3e-05|22.9|48/106|DUF3392| HM:PFM:REP 44->88|PF11297|0.00022|32.5|40/64|DUF3098| OP:NHOMO 384 OP:NHOMOORG 355 OP:PATTERN -------------------------------------------------------------------- --1----------1-------1---2------------1-----------------------------1-----------------------------------------------------------------------------1-1---------------11---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111111------------111111111-1-1---113111111--1--------11---------1----111------------1111-111-1111----11-1--1-----1111-11111111-1111111-1284111111-1-----112---1----111111-11--1--------------------------------------------------------------111--11----111111--1111-1--11--------------1-1111-1111111111-111111111111111111111111-1-1111111111111111111111111-111111111111---------11111---1111111111111---111111111111111-11111-1111-11----------11111111111111----------------1-------------------------------------------------------- 112211--1------11-1-11-11111111111-111111111111111-1-111111111----------------------------1-1------1--------1-2112111-1---1--1---262-12111111-121-1--11-1111121-1-------11-11--------------1-1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 97-102| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //