[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : potB
DDBJ      :potB         spermidine/putrescine transport system permease protein potb
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  569/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.37.1f.58.1
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   284->402 3d31C PDBj 5e-05 24.8 %
:RPS:PDB   308->345 3dhwA PDBj 4e-08 26.3 %
:RPS:SCOP  3->66 1n0uA2  c.37.1.8 * 9e-04 33.3 %
:RPS:SCOP  196->399 2r6gF2  f.58.1.1 * 2e-20 17.2 %
:RPS:PFM   278->365 PF00528 * BPD_transp_1 9e-11 30.7 %
:HMM:PFM   224->404 PF00528 * BPD_transp_1 1.3e-13 18.9 159/185  
:BLT:SWISS 196->407 POTB_SALTY 1e-37 37.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22139.1 GT:GENE potB GT:PRODUCT spermidine/putrescine transport system permease protein potb GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1271507..1272754) GB:FROM 1271507 GB:TO 1272754 GB:DIRECTION - GB:GENE potB GB:PRODUCT spermidine/putrescine transport system permease protein potb GB:PROTEIN_ID AAZ22139.1 GB:DB_XREF GI:71063136 GB:GENE:GENE potB LENGTH 415 SQ:AASEQ MSTEKILSSDGIPLEISLKKAERKNKLKALMLVGPLFLFLIITYIFPIGDMLFRSVDDRMITQKLPNTFAALEKWDGKELPDEATYEAFYKDFYPLAINKEAGKLYQRLNYEKSGFSSGLKKTNRKIKKFEKANYKEQFMATHKIWRNVDYWIALKNTAPNWSYAKYLKGLDLKFDQDRNIIQQDEDRRIHKILWLRTIKVAFWVTVFCFLLAYPISHLLATLPMKYSNLLMICVLLPFWTSLLVRTSSWMVLLQQQGPINDLIVWLGWAADDNRPELMYNVVGTFVAMTQILLPFMVLPLYSVMKTISPSLMRAGKSLGGTPFTAFRQIYFPLTIPGIGAGCLLVFILAIGYYITPALVGGASGSLISNTIAYHMKSSLDWSFAAALGSMLLVGVLTIYWIYNKLVGIDNIKLG GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 196->407|POTB_SALTY|1e-37|37.1|210/287| TM:NTM 6 TM:REGION 30->52| TM:REGION 191->213| TM:REGION 220->242| TM:REGION 280->302| TM:REGION 345->367| TM:REGION 388->410| BL:PDB:NREP 1 BL:PDB:REP 284->402|3d31C|5e-05|24.8|117/248| RP:PDB:NREP 1 RP:PDB:REP 308->345|3dhwA|4e-08|26.3|38/203| RP:PFM:NREP 1 RP:PFM:REP 278->365|PF00528|9e-11|30.7|88/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 224->404|PF00528|1.3e-13|18.9|159/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 2 RP:SCP:REP 3->66|1n0uA2|9e-04|33.3|48/323|c.37.1.8| RP:SCP:REP 196->399|2r6gF2|2e-20|17.2|204/244|f.58.1.1| OP:NHOMO 1314 OP:NHOMOORG 587 OP:PATTERN --1-------------2-11---122212--------1-1-----------------22-1------- -11-3----------------1---3------1111----11--------------------2-2--2111-------11--1-----1111-1-----------1------------------1-----------11111---12--11--112-----------12112--------------11111--1-2222222212222123-111-2211221211111111321111111-111111-211112112111-11111111111-11211111111111111111111111111111111111111111111111--112111111111111111121111113111-11---1-1-------1----1111-------98A214222112244244-44A-116115137J1-B99D459C8BEDA4---34B859AA56111111111----113-----------------------------1---1-255326666581122199BC55452485C1-21--11133---13A44E111----2211111-1221---1-4---32--41131--------------2-2---------------------------214-313----1111111111111111111------1------23321523333333333-3333332323333333333333441-23233333332333333322222221-222222222222---------11111-214111422112112223--------111-54444575455552555111111111-11122222212111111111111--------211----11111111-1111111---1-1--111-11-1-1111--1111121-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1----------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 37.3 SQ:SECSTR ###################################################################################################################################################################################################################################################HHHHHHHHHHHHHHccHHHHHHHH########HHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHcTTccHHHHHHHHHHHcTTTTTHHHHHHHHHHHHHHHHHcccc######### DISOP:02AL 1-5, 8-9, 15-18, 20-22, 414-415| PSIPRED cccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //