[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ppdk
DDBJ      :ppdk         phosphate dikinase (PPDK)
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  807/915 : Eukaryota  39/199 : Viruses  0/175   --->[See Alignment]
c.1.12c.8.1d.142.1
:887 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->873 1kblA PDBj 0.0 54.5 %
:RPS:PDB   23->886 1dikA PDBj 0.0 56.0 %
:RPS:SCOP  23->391 1dikA3  d.142.1.5 * e-115 54.6 %
:RPS:SCOP  392->518 1dikA2  c.8.1.1 * 5e-30 63.0 %
:RPS:SCOP  523->886 1dikA1  c.1.12.2 * e-126 55.2 %
:HMM:SCOP  1->394 1vbgA3 d.142.1.5 * 1.5e-148 48.8 %
:HMM:SCOP  390->522 1kblA2 c.8.1.1 * 5e-39 39.8 %
:HMM:SCOP  523->885 1kblA1 c.1.12.2 * 5e-134 44.6 %
:RPS:PFM   23->365 PF01326 * PPDK_N 5e-48 46.8 %
:RPS:PFM   435->516 PF00391 * PEP-utilizers 5e-16 52.9 %
:RPS:PFM   533->883 PF02896 * PEP-utilizers_C 4e-68 50.7 %
:HMM:PFM   531->882 PF02896 * PEP-utilizers_C 6.1e-104 45.5 288/294  
:HMM:PFM   23->376 PF01326 * PPDK_N 1.1e-67 36.6 287/329  
:HMM:PFM   428->516 PF00391 * PEP-utilizers 5.1e-25 45.5 77/81  
:BLT:SWISS 23->884 PPDK_RHIME 0.0 57.5 %
:PROS 463->474|PS00370|PEP_ENZYMES_PHOS_SITE
:PROS 774->792|PS00742|PEP_ENZYMES_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21439.1 GT:GENE ppdk GT:PRODUCT phosphate dikinase (PPDK) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 605086..607749 GB:FROM 605086 GB:TO 607749 GB:DIRECTION + GB:GENE ppdk GB:PRODUCT phosphate dikinase (PPDK) GB:PROTEIN_ID AAZ21439.1 GB:DB_XREF GI:71062436 GB:GENE:GENE ppdk LENGTH 887 SQ:AASEQ MNKLILNFKSKDSKKIKNPKNFLGGKGANLSEMGRMGLPVPPGFTISTKVCELFYKDKKKLNSKIVNIIKKELKIIEKEVGKKFGDLKNPLLLSVRSGARVSMPGMMDTILNLGLNDKTVLALSKKTSNSRFAKDSYRRFIQMYGNVVMGVEGYHFEELIENYKLTKGVLLDTDLDADDWEGLINDFKKVIKDQTKKEFPQNVYNQLLGAISSVFLSWESNRAKVYRKLNQIPAEWGTAVNVQSMVFGNMGNDCATGVVFTRNPSDGVNEVYGEYLINAQGEDVVAGTRTPQYITKKARKDAKAKEASMEEAMPKVFKQLDKILKILEKHYKDMQDVEFTVENNKLWMLQTRSGKRTSKSAVRIAVDMVKEKLISKKEAVMRIDPASLDTLLHPTLDEKNTLNVIANGLPASPGAASGKVVFTSEEAERLNNVMQDTILVRVETSPEDIHGMHAAKGILTARGGMTSHAAVVARGMGRPCVSGSSEIDINYEAKTFKTSSIEIKEGDIITIDGSTGRIILGEVPTVKPEISGDFSKLMSWADNFRKLKVRTNSETPLDTKTARDFGAEGIGLCRTEHMFFDEERILSVREMILSKTVEDRNRALAKLLPHQKKDFVQIFKIMNGLPVTVRLLDPPLHEFLPKTEKEINDVAKVVGLPLKEIESRINELHEQNPMLGHRGCRLGISFPEIYEMQCRAIFEALSELKIKKIKSAFPEIMIPLVSTEAEIRIMKDLVVRVAKEVQKDKKIKIDYLVGTMIELPRAAIKADDIAKHAEFFSFGTNDLTQTTFGLSRDDSGKFLNDYLENKIFSIDPFISIDDGVGDLIEIAVEKGRKTNKKIKLGICGEHGGDPKSIHFCANAGLDYVSCSPYRVPVARLAAAQAELSKKN GT:EXON 1|1-887:0| BL:SWS:NREP 1 BL:SWS:REP 23->884|PPDK_RHIME|0.0|57.5|862/898| PROS 463->474|PS00370|PEP_ENZYMES_PHOS_SITE|PDOC00527| PROS 774->792|PS00742|PEP_ENZYMES_2|PDOC00527| SEG 7->22|nfkskdskkiknpknf| SEG 64->83|kivniikkelkiiekevgkk| SEG 296->315|kkarkdakakeasmeeampk| SEG 762->771|aaikaddiak| SEG 807->818|ifsidpfisidd| BL:PDB:NREP 1 BL:PDB:REP 23->873|1kblA|0.0|54.5|839/872| RP:PDB:NREP 1 RP:PDB:REP 23->886|1dikA|0.0|56.0|848/869| RP:PFM:NREP 3 RP:PFM:REP 23->365|PF01326|5e-48|46.8|282/315|PPDK_N| RP:PFM:REP 435->516|PF00391|5e-16|52.9|70/79|PEP-utilizers| RP:PFM:REP 533->883|PF02896|4e-68|50.7|296/300|PEP-utilizers_C| HM:PFM:NREP 3 HM:PFM:REP 531->882|PF02896|6.1e-104|45.5|288/294|PEP-utilizers_C| HM:PFM:REP 23->376|PF01326|1.1e-67|36.6|287/329|PPDK_N| HM:PFM:REP 428->516|PF00391|5.1e-25|45.5|77/81|PEP-utilizers| GO:PFM:NREP 7 GO:PFM GO:0005524|"GO:ATP binding"|PF01326|IPR002192| GO:PFM GO:0016301|"GO:kinase activity"|PF01326|IPR002192| GO:PFM GO:0016310|"GO:phosphorylation"|PF01326|IPR002192| GO:PFM GO:0016310|"GO:phosphorylation"|PF00391|IPR008279| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF00391|IPR008279| GO:PFM GO:0016310|"GO:phosphorylation"|PF02896|IPR000121| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF02896|IPR000121| RP:SCP:NREP 3 RP:SCP:REP 23->391|1dikA3|e-115|54.6|357/375|d.142.1.5| RP:SCP:REP 392->518|1dikA2|5e-30|63.0|127/129|c.8.1.1| RP:SCP:REP 523->886|1dikA1|e-126|55.2|364/365|c.1.12.2| HM:SCP:REP 1->394|1vbgA3|1.5e-148|48.8|377/0|d.142.1.5|1/1|Glutathione synthetase ATP-binding domain-like| HM:SCP:REP 390->522|1kblA2|5e-39|39.8|133/0|c.8.1.1|1/1|Phosphohistidine domain| HM:SCP:REP 523->885|1kblA1|5e-134|44.6|363/0|c.1.12.2|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 1666 OP:NHOMOORG 910 OP:PATTERN 11111-11111111111122211111113-21-12111111112211212322111111111111-11 -11111-1111-1--3111-1111211111111121-3-31-1--1-1----122-----1112-1-1211-----11211221111111111111--------11--1---------------122222212221233331112123311121111------11112-22------------23-22213212111111111111111111122111111121122222233211111111111111222222211221211122222221111111122221112111111111111111222222222122111111112221222222222222-2223222321121322211122121122222221-22244311111244431111121111111111112-22322232131-12221111111122111212212211111111111111-3332111111111111111111111111111111143212222212222223333443433333323423321223324121133323222222241111111122222212632222222332123324444422222324-----------111111111-1112113332211221333333243332333333321-2312211-11133333323333343433-3333433333333333333333323333333333333323333333333333-333333333333-111111112222122321111111111111111111113111414434444433333333311111111112224333333433332333332222222--2311111111111111311----1---111-1111111111---1111121111222 --------2111-------11-1---1----------------------111-B---1---------------------------------------------------2------------------------------------------------1----2---------111222W2221-2243-21124333- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 864 STR:RPRED 97.4 SQ:SECSTR ######################HHHHHHHHHHHHHHTcccccEEEEccHHHHHHHTTTccccHHHHHHHHHHHHHHHHHTTcEETccccEEcEEEEEEEccccTTTccEEEEETccTTHHHHHHHHHccHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTTTcccGGGccHHHHHHHHHHHHHHHHTcccccccccHHHHHHHHHHHHHHHTTcHHHHHHHHHTTccTTccEEEEEEEcccccccTTcEEEEEEEEcTTTccEEEEEEEEEcccHHHHTccccccEETTTHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEEEETTEEEEEEcccccccHHHHHHHHHHHHHTTcccHHHHHHHccGGGGGTTTcccccHHHTccccEEcEEEEccEEEEEEEccHHHHHTTccTTccEEEEEccccGGGHHHHHHccEEEEccccTTcHHHHHHHHHTcEEEEccTTcEEETTTTEEEETTEEEcccEEEEETTcEEEcccccccHHcccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHTTcccEEEEEcTHHHHcHHHHHHHHHHHHcccHHHHHHHHHTTHHHHHHHHHHHHHHHTTccEEEEcccccGGGTccccHHHHHHHHHTTTccHHHHHHHHHTTccccTTccccTHHHHHHcHHHHHHHHHHHHHHHHHHHHTTccccccEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccHHHHHTHHHHHHHccEEEEEHHHHHHHHHTccHHHHHHHHHHHHHTTccccTTTcccTTTHHHHHHHHHHHHHHHcTTcEEEEEcTTTTcHHHHHHHHHHTccEEEEcTTTHHHHHHHHHHHHHHHc# DISOP:02AL 884-887| PSIPRED cccEEEEccccccccccccHHHcccccccHHHHHHccccccccEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccEEEEEEEccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHEEccccccEEEEEEEEEcHHHHHHHcccccEEEEEccccHHHHHHHHHHHEEEEccccccHHHHHHHHHHcccEEEEcccccccHHHHHEEEHHEEEccccEEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccccHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEHHHHHHHHHHHHHHHccEEEEccHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHccHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHcc //