[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ppiB
DDBJ      :ppiB         peptidylprolyl isomerase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  698/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->139 2nulA PDBj 2e-21 44.6 %
:RPS:PDB   1->157 3bo7B PDBj 4e-34 25.5 %
:RPS:SCOP  8->157 1a33A  b.62.1.1 * 7e-30 31.2 %
:HMM:SCOP  1->161 1z81A1 b.62.1.1 * 2.6e-50 49.7 %
:RPS:PFM   8->139 PF00160 * Pro_isomerase 9e-29 54.5 %
:HMM:PFM   5->158 PF00160 * Pro_isomerase 3.6e-51 47.8 138/155  
:BLT:SWISS 1->156 PPI1_BRUSU 8e-54 64.5 %
:PROS 35->52|PS00170|CSA_PPIASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21795.1 GT:GENE ppiB GT:PRODUCT peptidylprolyl isomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 969517..969996 GB:FROM 969517 GB:TO 969996 GB:DIRECTION + GB:GENE ppiB GB:PRODUCT peptidylprolyl isomerase GB:PROTEIN_ID AAZ21795.1 GB:DB_XREF GI:71062792 GB:GENE:GENE ppiB LENGTH 159 SQ:AASEQ MILKLKDGDVKIELFEDVAPNHVKRIKQLAKDGKYDGVVFHRVIDGFMAQTGDVQFGNSSNDQFDLRRAGMGGSDLPDLKEEFSDLPHERGTLSMARSQDPNSANSQFFICFKEASFLDRQYTVFGKVIEGMDLVDKIKRGDQNNNGSVSNPDKIISFK GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 1->156|PPI1_BRUSU|8e-54|64.5|155/196| PROS 35->52|PS00170|CSA_PPIASE_1|PDOC00154| BL:PDB:NREP 1 BL:PDB:REP 8->139|2nulA|2e-21|44.6|121/163| RP:PDB:NREP 1 RP:PDB:REP 1->157|3bo7B|4e-34|25.5|153/167| RP:PFM:NREP 1 RP:PFM:REP 8->139|PF00160|9e-29|54.5|121/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 5->158|PF00160|3.6e-51|47.8|138/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 8->157|1a33A|7e-30|31.2|141/174|b.62.1.1| HM:SCP:REP 1->161|1z81A1|2.6e-50|49.7|149/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 3402 OP:NHOMOORG 922 OP:PATTERN ------------------------1111111-111---22221221-111111--------1----22 112-1----------1-----1---1------111121---222-1--------1-------1---212---------2121---1--111--1-----112322-2221--------------111111211232222221112-2112221222232222212131124122211121221333-----11111111111-111111211111111-11221111111133-11111111111111111112111111111111--1111111-222111112122122222222222-1111111111112221112221-211211111112122111122221111121111111-1---------113-3233322222222222222222222222222222-22222222222-2222222222222232222222222221111111111111221--------11-------------------22222211111222222222222222222222222222222222222222212222222322222222222222222122111322122222222122222---13212111-1--1----11111111121-211222322325124444433444443444424--211-1------22222222222222122-2222222222222222222222222222222222222222222222222222-222222222222---2-----22221221211111211111111222222121112222222222222222222---------233332222233322111111111111112112111111---1-1111-2------------------------------------12 4333988-E5625895877766888968746456555977788766437875775787787784734543455243545545553376-9DA87A89A88835CBA26UCPKJHFKD54965D7QG4g7k*Y1KNb5747F66GD7B36CC45J4BCECCEL9C892C9DHGCGB2FCC*DCCCBRDLT9LFECCA89Q ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 100.0 SQ:SECSTR EEEEETTEEEEEEEcTTTcHHHHHHHHHHHTTTTTTTccEEEEETTTEEEEccGGGccccccTccccccccccTTcccccccccTcccccccEEEEccccTTcccccEEEEccccGGGTTTccEEEEEEEcHHHHHHHTTccccTTccccccccEEEEE DISOP:02AL 140-150| PSIPRED cEEEEcccEEEEEEccccccHHHHHHHHHHccccccccEEEEEEccEEEEEccccccccccccEEccccccccccccccccccccccccccEEEEEccccccccccEEEEEEcccccccccEEEEEEEEccHHHHHHHHcccccccccccccEEEEEEc //