[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ppnK
DDBJ      :ppnK         probable inorganic polyphosphate/ATP-NAD kinase (Poly(P)/ATP NAD kinase)
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  725/915 : Eukaryota  60/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->179 2an1D PDBj 6e-17 37.0 %
:RPS:PDB   32->248 2an1A PDBj 1e-22 25.1 %
:RPS:SCOP  35->233 1u0rA  e.52.1.1 * 2e-36 24.5 %
:HMM:SCOP  5->242 1suwA_ e.52.1.1 * 5.3e-53 27.6 %
:RPS:PFM   33->220 PF01513 * NAD_kinase 3e-20 37.6 %
:HMM:PFM   32->226 PF01513 * NAD_kinase 1.3e-31 29.1 189/285  
:BLT:SWISS 34->251 PPNK_CAUCR 2e-56 44.0 %
:REPEAT 2|104->151|166->212
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21935.1 GT:GENE ppnK GT:PRODUCT probable inorganic polyphosphate/ATP-NAD kinase (Poly(P)/ATP NAD kinase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1087948..1088727) GB:FROM 1087948 GB:TO 1088727 GB:DIRECTION - GB:GENE ppnK GB:PRODUCT probable inorganic polyphosphate/ATP-NAD kinase (Poly(P)/ATP NAD kinase) GB:PROTEIN_ID AAZ21935.1 GB:DB_XREF GI:71062932 GB:GENE:GENE ppnK LENGTH 259 SQ:AASEQ MRDKVYLVFDKTKVSLKIKSILIKKVNITSLRKSNIIIVLGGDGFMLQTLKKLHKYKKPFYGINSGNYGFLMNKFSNENFIKNLNISNSVKIYPLQMTVTNKKNQTKKSIAINEVSILRQSKQASSISITANNKNIIKNLISDGVLVSTPAGSTAYNLSAHGPILNLDSRKLAVTPISPFRPRRWKGTIISDKSKILIKNLDTNKRPISAVADNFEVRNAKTIKIQANKKISFELLYDKNNSLHKKIKIEQTRKETSNN GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 34->251|PPNK_CAUCR|2e-56|44.0|218/260| NREPEAT 1 REPEAT 2|104->151|166->212| SEG 13->26|kvslkiksilikkv| BL:PDB:NREP 1 BL:PDB:REP 32->179|2an1D|6e-17|37.0|146/268| RP:PDB:NREP 1 RP:PDB:REP 32->248|2an1A|1e-22|25.1|211/275| RP:PFM:NREP 1 RP:PFM:REP 33->220|PF01513|3e-20|37.6|181/240|NAD_kinase| HM:PFM:NREP 1 HM:PFM:REP 32->226|PF01513|1.3e-31|29.1|189/285|NAD_kinase| GO:PFM:NREP 2 GO:PFM GO:0003951|"GO:NAD+ kinase activity"|PF01513|IPR002504| GO:PFM GO:0008152|"GO:metabolic process"|PF01513|IPR002504| RP:SCP:NREP 1 RP:SCP:REP 35->233|1u0rA|2e-36|24.5|196/281|e.52.1.1| HM:SCP:REP 5->242|1suwA_|5.3e-53|27.6|232/249|e.52.1.1|1/1|NAD kinase| OP:NHOMO 846 OP:NHOMOORG 814 OP:PATTERN -----1---------1-2-----1-------111111111111111-111111-1--1-1----1--- 1--1211111111111111-1111111111111111--11-1---11--1111111-1111-1-1------11111111--1111-1-11111111---111111111-1--------------111111111111-----111--1221222-111111111111221-1211212112112-----1-11-----------------121121--------1-------21211111111111111-11-1-1-1--11111--11----111----11111111111111111111111111111111111111111111-11111111111-1-111111111111111111111111111-11111111-1111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-111111-111111--1111-11111111111111111111111111-11--111-11-111111-1--1-1111111111111111111111111--11111-1111111111111111111111111-1-11111-11111111111111111111-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111-11111--1-1----1---1111111111111-----------111111111111111111------111111111------------------------1111-1--11111111 -----11-211111-11-------------------------------111111---111-11-111-1-221-123-221----111-1111111-----211-1-1---------------------------------------------------------11---3-------1-111--1-1------2-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 85.3 SQ:SECSTR ###########################EEEHHHccEEEEcccHHHHHHHHHHHTTcccEEEEcccccccccccccTTcHHHHHHHHHTTcEEEEEEEEEEEEEEcccEEEEccEEEEEEccTTccEEEEEEETTEEEEEEEEcEEEEEcTGGGGTHHHHTTcccccTTccEEEEEEEccccTHTcccEEEETTccEEEEHHHEEcccEEEEETTEEEcTTcEEEEEEEEEEEEEEEEETTccHHHHHH########### DISOP:02AL 255-259| PSIPRED cccEEEEEEcccHHHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHcccccEEEEEEcccccEEEccccHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEccEEEEEccccHHHHHHHccccEEcccccEEEEEEEccccccccccEEEccccEEEEEEEccccEEEEEEcccEEEccccEEEEEEccccEEEEEEcccccHHHHHHHHHcccccccc //