[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : proB
DDBJ      :proB         Glutamate 5-kinase
Swiss-Prot:PROB_PELUB   RecName: Full=Glutamate 5-kinase;         EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase;         Short=GK;

Homologs  Archaea  9/68 : Bacteria  722/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.73.1d.276.1
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->366 2j5tD PDBj 6e-68 38.0 %
:RPS:PDB   34->364 3c1nB PDBj 2e-36 14.1 %
:RPS:SCOP  7->256 2akoA1  c.73.1.3 * 1e-36 30.8 %
:RPS:SCOP  230->367 1rylA  d.276.1.1 * 6e-25 12.0 %
:HMM:SCOP  37->257 2ij9A1 c.73.1.3 * 5.3e-60 33.0 %
:HMM:SCOP  277->368 2cx1A1 b.122.1.1 * 3.7e-25 43.5 %
:RPS:PFM   9->223 PF00696 * AA_kinase 1e-13 35.4 %
:RPS:PFM   278->351 PF01472 * PUA 5e-12 44.6 %
:HMM:PFM   7->237 PF00696 * AA_kinase 8.6e-46 36.4 217/243  
:HMM:PFM   278->351 PF01472 * PUA 6.1e-24 40.5 74/74  
:BLT:SWISS 1->368 PROB_PELUB 0.0 100.0 %
:PROS 209->226|PS00902|GLUTAMATE_5_KINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21044.1 GT:GENE proB GT:PRODUCT Glutamate 5-kinase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 222512..223618 GB:FROM 222512 GB:TO 223618 GB:DIRECTION + GB:GENE proB GB:PRODUCT Glutamate 5-kinase GB:PROTEIN_ID AAZ21044.1 GB:DB_XREF GI:71062041 GB:GENE:GENE proB LENGTH 368 SQ:AASEQ MYLKDSKIIVIKIGSSLLIDDKKKVRRKWLTEFAKDIQELIKQNKKVIIVSSGAIAMGCKKLNISKKNLKIDKSQAVASIGQIELMNLFSETFVKLKINISQILLTLEDTEQRRRALNAKRTFDNLFKLGFVPIVNENDTIATSEIKYGDNDRLASRVAQISGADSLILLSDVDGLYTHNPKIYKNAKLIKEIRNIDKDIEKIATKSISEHGTGGMKTKIDAAKICQLSGCQMVIANGLVNRPIKKITEENKCTWFLPKVSKLDARKKWIISSVSPKGALIIDDGAKQALSNGKSLLAAGIKKVSGRFSKGDHIKVLDKNNYECARGLSSFSSNEIEKIMGHHSKEIEKLLGYISKSEVIHKDDIVEV GT:EXON 1|1-368:0| SW:ID PROB_PELUB SW:DE RecName: Full=Glutamate 5-kinase; EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase; Short=GK; SW:GN Name=proB; OrderedLocusNames=SAR11_0223; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Proline biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|PROB_PELUB|0.0|100.0|368/368| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 209->226|PS00902|GLUTAMATE_5_KINASE|PDOC00701| SEG 60->74|kklniskknlkidks| BL:PDB:NREP 1 BL:PDB:REP 5->366|2j5tD|6e-68|38.0|361/365| RP:PDB:NREP 1 RP:PDB:REP 34->364|3c1nB|2e-36|14.1|313/459| RP:PFM:NREP 2 RP:PFM:REP 9->223|PF00696|1e-13|35.4|198/244|AA_kinase| RP:PFM:REP 278->351|PF01472|5e-12|44.6|74/74|PUA| HM:PFM:NREP 2 HM:PFM:REP 7->237|PF00696|8.6e-46|36.4|217/243|AA_kinase| HM:PFM:REP 278->351|PF01472|6.1e-24|40.5|74/74|PUA| GO:PFM:NREP 2 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| GO:PFM GO:0003723|"GO:RNA binding"|PF01472|IPR002478| RP:SCP:NREP 2 RP:SCP:REP 7->256|2akoA1|1e-36|30.8|237/241|c.73.1.3| RP:SCP:REP 230->367|1rylA|6e-25|12.0|125/157|d.276.1.1| HM:SCP:REP 37->257|2ij9A1|5.3e-60|33.0|218/0|c.73.1.3|1/1|Carbamate kinase-like| HM:SCP:REP 277->368|2cx1A1|3.7e-25|43.5|92/0|b.122.1.1|1/1|PUA domain-like| OP:NHOMO 1011 OP:NHOMOORG 906 OP:PATTERN ---------------------------111-1-----------------1111--------1------ -1-1111111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111211111111111111111-1111111111112111-------1-11-221111111--111111111111-111111--1111111111111111111111111111111111111-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221222222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------111111111111111111111111111111111111111---------1---------------------------11--1-111111 --11111-31--111111-1111111111111111111111111111-11111111111111111111-1221112212211111111-11111111-11111311--2-22322211-11-11111112B2--2311-1211111--1111111111211--111-1112122-1212E2221112331112133321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 366 STR:RPRED 99.5 SQ:SECSTR HHHHTccEEEEEEcHHHHcccccTccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEETEEEcccTTcccEEEEcHHHHHHHHHHTTcEEEEETTEEEcEEEccTTHHHHHHHHHHHHHTccEEEEEEcccccccccTTTcTTcccccEEEHHHHHHHHTcccGHHHccTTcccccHHHHHHHHHHTccEEEEEcccTTcccEEEEcccccccccEEEEEEEEEEEEEEEccccTTccHHHHHHHHHHTTTccTTccEEEEEccTTccEEEEEEETTcHHHHHHHHHHHTcccccccEEEEEEEEEEEEEEEEccTTTTcTTH## DISOP:02AL 264-267, 269-272| PSIPRED cccccccEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccEEEEEcccEEEcccccccccHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHcccccEEEEEccccHHHHHHHHHHccccccEEEEcHHHHHHHHccccccccccEEEEEccccccEEEEEcccccEEEEEEEcccHHHHHHHHcccHHHHHHHcccccccEEEEEccEEEc //