[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : proS
DDBJ      :proS         proline-tRNA ligase
Swiss-Prot:SYP_PELUB    RecName: Full=Prolyl-tRNA synthetase;         EC=6.1.1.15;AltName: Full=Proline--tRNA ligase;         Short=ProRS;

Homologs  Archaea  31/68 : Bacteria  821/915 : Eukaryota  155/199 : Viruses  0/175   --->[See Alignment]
c.51.1d.104.1
:444 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->408 2i4nB PDBj e-125 55.4 %
:RPS:PDB   16->439 1b76A PDBj 3e-45 17.5 %
:RPS:SCOP  26->210 1evkA2  d.104.1.1 * 1e-51 23.5 %
:RPS:SCOP  278->332 1h4qA2  d.104.1.1 * 2e-05 25.5 %
:RPS:SCOP  337->444 1g5hA1  c.51.1.1 * 4e-14 12.3 %
:HMM:SCOP  9->351 1atiA2 d.104.1.1 * 7.5e-87 37.8 %
:HMM:SCOP  336->440 1hc7A1 c.51.1.1 * 2e-18 29.5 %
:RPS:PFM   49->168 PF00587 * tRNA-synt_2b 8e-20 35.8 %
:RPS:PFM   363->437 PF03129 * HGTP_anticodon 6e-06 33.3 %
:HMM:PFM   51->216 PF00587 * tRNA-synt_2b 2.2e-37 26.1 165/173  
:HMM:PFM   350->437 PF03129 * HGTP_anticodon 9.3e-13 21.8 87/94  
:HMM:PFM   263->378 PF00009 * GTP_EFTU 1.3e-05 19.6 112/189  
:BLT:SWISS 1->444 SYP_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21716.1 GT:GENE proS GT:PRODUCT proline-tRNA ligase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 866512..867846 GB:FROM 866512 GB:TO 867846 GB:DIRECTION + GB:GENE proS GB:PRODUCT proline-tRNA ligase GB:PROTEIN_ID AAZ21716.1 GB:DB_XREF GI:71062713 GB:GENE:GENE proS LENGTH 444 SQ:AASEQ MYISKSFIPILKNNPSEAKIKSHQLMLRVGMIKQSSAGIYSWLPLGFKVMKKIEQIVREEQNKIGAQEILMPTIQPSDIWKESGRYDDYGDEMLRIKDRQGREMLYGPTNEELVTDIFRSSVKSYKSLPQLLYHIQWKFRDEVRPRFGIMRGREFYMKDAYSFDVNDEDATFSYNKFFFSYLKTFKRLELSAIPMAADTGPIGGNLSHEFIILADTGESKIFTDKRVFDLGSEGTVLDRQSLQDLRKKYEQYYAVADEKFNKNEFEEKVSEENRLITKGIEVGHIFYFGDKYSKALNAAVDLPGGKKDFVKMGSYGIGVSRLVGAIIEAKYDQKDEIMKWPFSVAPYELAIIPMINKNDTSALDKANKLFKHFESKNIDTIIDDMDENLSSKIKKFNLIGVPYQIILGKNSEDNLLEFKEIGKDPKSLTLDQITQILTEQKLKN GT:EXON 1|1-444:0| SW:ID SYP_PELUB SW:DE RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1.15;AltName: Full=Proline--tRNA ligase; Short=ProRS; SW:GN Name=proS; OrderedLocusNames=SAR11_0902; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->444|SYP_PELUB|0.0|100.0|444/444| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 258->273|ekfnknefeekvseen| BL:PDB:NREP 1 BL:PDB:REP 1->408|2i4nB|e-125|55.4|404/442| RP:PDB:NREP 1 RP:PDB:REP 16->439|1b76A|3e-45|17.5|382/442| RP:PFM:NREP 2 RP:PFM:REP 49->168|PF00587|8e-20|35.8|120/170|tRNA-synt_2b| RP:PFM:REP 363->437|PF03129|6e-06|33.3|75/91|HGTP_anticodon| HM:PFM:NREP 3 HM:PFM:REP 51->216|PF00587|2.2e-37|26.1|165/173|tRNA-synt_2b| HM:PFM:REP 350->437|PF03129|9.3e-13|21.8|87/94|HGTP_anticodon| HM:PFM:REP 263->378|PF00009|1.3e-05|19.6|112/189|GTP_EFTU| GO:PFM:NREP 9 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF03129|IPR004154| GO:PFM GO:0005524|"GO:ATP binding"|PF03129|IPR004154| GO:PFM GO:0006412|"GO:translation"|PF03129|IPR004154| RP:SCP:NREP 3 RP:SCP:REP 26->210|1evkA2|1e-51|23.5|183/291|d.104.1.1| RP:SCP:REP 278->332|1h4qA2|2e-05|25.5|54/264|d.104.1.1| RP:SCP:REP 337->444|1g5hA1|4e-14|12.3|106/127|c.51.1.1| HM:SCP:REP 9->351|1atiA2|7.5e-87|37.8|299/394|d.104.1.1|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 336->440|1hc7A1|2e-18|29.5|105/127|c.51.1.1|1/1|Class II aaRS ABD-related| OP:NHOMO 1413 OP:NHOMOORG 1007 OP:PATTERN --1--11211111112-111111--------------11111-------1111-1--1------11-- 1111211111111111111-11--11111111111111111--111111111111111111111111121111111112121-21121------221--1----1-----11111111111111--1-2112-212----12222-1112111111111111111112211222222222222-------1-1111111111111111122111111121121222222221311111111111111111111211111111112211111121111112222222222222222222222222222222222222222222221-1111111111-1-1--1111-2211-1-111111121-111112111-2-222211111111211111111111111111111111111111112111111111111111221111111111111111111122121222221111222112222222222222222221111111112222222222222242222222222222222222212222222222212222222222222222222----211111111111111111111111--112121211111122222222222122111112222122222222222222212222221-1122111111121111111111111111-1111111111111111111222111111111111111111111111111111211111111111122122222211112222211122211111111212222212222222222222222222222222222222122212222222222111111111111111212222222--------22-----------1--------------1111111211-1- 22--222-2-----111222222222222121212122-1111222111111111111222211132331212212212132222211---111--111-111122-1221-21111111111132111121-111-1--11111----11--1-111211111111111-12-3----------2--321-222231- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 444 STR:RPRED 100.0 SQ:SECSTR cHHHHHTcccccEEEccccHHHHHHHHHTTcEEETTTTcEEEcHHHHHHHHHHHHHHHHHTccccEEEEccccEEEHHHHHHTcHHHHcEEEEcccccccccccEcccTHHHHHTTHHHHHHHHTccccEEEEEEEEEEcccccccTTTTcccEEEEEEEEEEEEcGGGHHHHHHHHHHHHHHHHHHTTccGGGccTTcccTTEEEEEEEEEEETTEEEEEEEEEEEccHHHHHTcTTTHHHHHcccTTTTTHHHHTcccGGGGccHHHEEEEHHcccTTTTTccccccccccccccccEEccccccEEcEEEEEEEEHHHHHHHHHHHHEEEEEcTEcccGGGccccEEEEEccccccHHHHHHHHHHHHHHHTTTcccEEEcccccHHHHHHHHHHTTccEEEEEcHHHHTccTTccccTccEEEEEHHHHHHHHHHHHHTc PSIPRED ccccHHHHHHHHHcHHHHccccHHHHHHHccccccccccEEEccHHHHHHHHHHHHHHHHHHHcccEEcccccEEcHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHcccHHHccEEEEEEEEEEccccccccccccEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEcccccEEEEEcHHHHHHHHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHcccEEEcccccEEEEEEcccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcHHHHccEEEEEEccccEEEEEHHHHHHHHHHHHHcc //