[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : proX
DDBJ      :proX         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  88/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:320 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   111->318 1r9lA PDBj 4e-09 23.4 %
:RPS:SCOP  24->318 1r9lA  c.94.1.1 * 2e-36 17.9 %
:HMM:SCOP  13->319 1r9lA_ c.94.1.1 * 5.8e-57 28.3 %
:RPS:PFM   26->308 PF04069 * OpuAC 4e-20 32.3 %
:HMM:PFM   25->309 PF04069 * OpuAC 6.1e-50 27.7 253/257  
:BLT:SWISS 111->318 PROX_ECOLI 1e-08 23.4 %
:PROS 233->261|PS00061|ADH_SHORT
:PROS 198->214|PS00196|COPPER_BLUE
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21615.1 GT:GENE proX GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 770785..771747 GB:FROM 770785 GB:TO 771747 GB:DIRECTION + GB:GENE proX GB:PRODUCT hypothetical protein GB:NOTE periplasmic components; similar to COG2113: ABC-type proline/glycine betaine transport systems GB:PROTEIN_ID AAZ21615.1 GB:DB_XREF GI:71062612 GB:GENE:GENE proX LENGTH 320 SQ:AASEQ MKIIKTTLVAGLISLFATFSTFAEKVKIGDPGWTGATAIANLLAAVVNDKMGGEAELVPGNNTAIYAAIDRSKGEIEVHPDIWLPNQQAYTNDLVPKGTLKLSSKPYEGNQGYCVSQQFAKKMNITAIEDLARPEVVKAMDSDGNGKGEFWIGADGWASANVNQVKLRDYGLYDAGIEAIRAAEAVKNARVLDSIKKGEGYAFYCYKPHAIWGMADVVMLTEPKFDEAKYKMVQPKEDADWYKKSYVASKDALKQIQIGWGTSLEAKSPAIVDFFKNFQLSADDVSLMAFQISVEKKDPADVARTWMKNNKSKVDGWLGL GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 111->318|PROX_ECOLI|1e-08|23.4|201/330| PROS 233->261|PS00061|ADH_SHORT|PDOC00060| PROS 198->214|PS00196|COPPER_BLUE|PDOC00174| TM:NTM 2 TM:REGION 1->23| TM:REGION 27->49| BL:PDB:NREP 1 BL:PDB:REP 111->318|1r9lA|4e-09|23.4|201/309| RP:PFM:NREP 1 RP:PFM:REP 26->308|PF04069|4e-20|32.3|251/256|OpuAC| HM:PFM:NREP 1 HM:PFM:REP 25->309|PF04069|6.1e-50|27.7|253/257|OpuAC| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF04069|IPR007210| GO:PFM GO:0005488|"GO:binding"|PF04069|IPR007210| GO:PFM GO:0006810|"GO:transport"|PF04069|IPR007210| RP:SCP:NREP 1 RP:SCP:REP 24->318|1r9lA|2e-36|17.9|290/310|c.94.1.1| HM:SCP:REP 13->319|1r9lA_|5.8e-57|28.3|293/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 112 OP:NHOMOORG 90 OP:PATTERN ------------------------------------------1------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------------------------------3-----------------------111111-11111111------111----1---------------------------------------------------------------------------------------------------------------------11-----1-------------1------------------------------------1111111-112---------11--1221-1211122-----1-1----1-1---------------------------------------------1------1112-----------------------------------1--1----------------------------11-1-----1-----------------1------------------------------------------1111-2--------------------------------------------------------------------------------------1---------1--------------------------------------------------------22121233-221--221-----------11-------11--------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 89.7 SQ:SECSTR #########################EEEEccccHHHHHHHHHHHHHH#HHHTcEEEEEcccHHHHHHHHHHT##cccEEEEEEETTTHHHHHHHHTTTcEEEEEEEEEEEEEEEEEHHHHHHHTcccGGGGGcHHHHGGGcccccccEEEEcccTTcHHHHHHHHHHHHTTcTTTTEEEEcccHHHHHHHHHHHHHTTcccEEEEEEcccHHHHTTEEEcccc###HHHccccTTcTTcccccTTccccccccEEEEEEEEHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHTcccHHHHHHHHHHHTHHHHHHHH## PSIPRED cHHHHHHHHHHHHHHcccHHHccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccEEEEcccccccEEEEEEcHHHHHHcccccHHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccEEEEEEcccHHHHcccEEEEEcccccccccccccccccccccccccccccccHHHEEEEccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc //