[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pstB
DDBJ      :pstB         phosphate ABC transporter
Swiss-Prot:PSTB_PELUB   RecName: Full=Phosphate import ATP-binding protein pstB;         EC=3.6.3.27;AltName: Full=Phosphate-transporting ATPase;AltName: Full=ABC phosphate transporter;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:255 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   17->254 2oukB PDBj 2e-31 36.6 %
:RPS:PDB   18->241 3b5jA PDBj 2e-44 29.3 %
:RPS:SCOP  15->254 1b0uA  c.37.1.12 * 3e-41 35.3 %
:HMM:SCOP  8->250 1g2912 c.37.1.12 * 4.1e-58 34.9 %
:RPS:PFM   76->180 PF00005 * ABC_tran 1e-10 41.2 %
:HMM:PFM   47->179 PF00005 * ABC_tran 2.6e-21 29.6 115/118  
:HMM:PFM   139->220 PF02463 * SMC_N 5.5e-06 28.0 82/220  
:HMM:PFM   15->56 PF03193 * DUF258 2.8e-06 26.8 41/161  
:BLT:SWISS 15->255 PSTB_PELUB e-139 100.0 %
:PROS 152->166|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21982.1 GT:GENE pstB GT:PRODUCT phosphate ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1129392..1130159) GB:FROM 1129392 GB:TO 1130159 GB:DIRECTION - GB:GENE pstB GB:PRODUCT phosphate ABC transporter GB:NOTE similar to ATP-binding protein Caulobacter crescentus CB15, pstB GB:PROTEIN_ID AAZ21982.1 GB:DB_XREF GI:71062979 GB:GENE:GENE pstB LENGTH 255 SQ:AASEQ MKNNKIKIKSSNLNVHYGEKQALFDVDLDIYDKEVTALIGPSGCGKSTFIRCINRMNDVIDICKVEGSITIDDEEIIDKNLDVVGLREKIGMVFQKPNPFPKSIYDNISYGPTIHGLTENKTDMDEIVENSLKKAALWNEVKDRLNEAGTGLSGGQQQRLCIARAISVNPQVILMDEPCSALDPIATAKIEELIDELKKSYTIVIVTHSMSQAVRVSQRTGFFHLGKIIEVDTTEKIFKNPGNKMTQDYITGRFG GT:EXON 1|1-255:0| SW:ID PSTB_PELUB SW:DE RecName: Full=Phosphate import ATP-binding protein pstB; EC=3.6.3.27;AltName: Full=Phosphate-transporting ATPase;AltName: Full=ABC phosphate transporter; SW:GN Name=pstB; OrderedLocusNames=SAR11_1176; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nucleotide-binding; Phosphate transport;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->255|PSTB_PELUB|e-139|100.0|241/255| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006817|"GO:phosphate transport"|Phosphate transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 152->166|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 2->14|knnkikikssnln| BL:PDB:NREP 1 BL:PDB:REP 17->254|2oukB|2e-31|36.6|227/241| RP:PDB:NREP 1 RP:PDB:REP 18->241|3b5jA|2e-44|29.3|215/243| RP:PFM:NREP 1 RP:PFM:REP 76->180|PF00005|1e-10|41.2|97/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 47->179|PF00005|2.6e-21|29.6|115/118|ABC_tran| HM:PFM:REP 139->220|PF02463|5.5e-06|28.0|82/220|SMC_N| HM:PFM:REP 15->56|PF03193|2.8e-06|26.8|41/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 15->254|1b0uA|3e-41|35.3|232/258|c.37.1.12| HM:SCP:REP 8->250|1g2912|4.1e-58|34.9|232/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 44112 OP:NHOMOORG 1174 OP:PATTERN SSL9PEGHTVUSVPYMgGLLFIEUrLNdkSbRGADDEAGGHGBSXSVnKQ**i9QYOPSJRJECV189 NRfE*TWVkkmNSIRPPMM-MU99V*MMMMMLheffh***FjR*cpmQgaZLuqlKKb88gpca*ap***TXVUUpbZcM*ebCADADNOLG6JEHK--EGOIHFXIULP7666666999AAAAGRPKRWMLURXObghrvGFGxQoikmedePYSULIKGLFWaQg***WINHKIJIMFJDHTNRHFtlAOYs********z***********z***ais**fjvvvttu**XhhhjhfdgghhhggZbYYZ*iYa**bMgborpOPz*aVRVkjdgirquvpnuutsqtoqomrvnrsaaaZYaabdbaZZzooefgpoqlm***********f*kt***bffd*qkyysntQI**reTYgpOTngmnPdYROZSPPMIKJILXS***SOj****t***********-eg*ca*c***MC**************GHHx***z*****POPPPPPPbNSDPbRt55545555656888BC88AA888898594JCBFBDy**v*******ouvxr*****z**ez******zAKprmwakil*x****YgjMSIMfOFGFFGDFQQMVeZZz*NdSoeTUpWVhJbaXTRUgQZLMOPlqSvKKIRGKJJMHFDBDFDEEDDIOGFIIGkioOnRaGTKwLTUVUNUXQPPSQRUZUYW5-DHULM222333*q**R*psuuytzv*qq-usrsvswswuv*upqrppo*****hgcikhhijjjjjghjhhh*lhknnopQ4y***********34EGCEBCDNOPOHE*g*XWVVVTKNQMMSLSbOPSQPHRDLOiZmonnt***kz*pra***EFEDDFEDFLcnmzmnnnnu*zzwINOIKJIIKKBBBB57KWKKIIKL87786889*8bDDBDE-EAGFHHDOOLCJLAHF99BbhtXTs*tprESK 4444aSC-SD36RbSFDLFELLGUITJFFBDCDOJJBIDGFEECCCHHNSNLZRHJLDFEDEDAD69827858AB7A27B68878957-FL8DCDGDA8EA7AJJC3Gae*QbTlZiJFHEHUIqpExD**f2lNnLHGEcCK*SEKHDAZDA*JTQPkKi*OtOLEwRc*jikY7BGC*8AAEEkcd*HpnHKsaidG ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-4| PSIPRED cccccEEEEEEEEEEEEccEEEEEcccEEEEccEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEEccEEcccccccHHHHHHHccEEEEccccccccHHHHcccccEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHccc //