[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : pstS
DDBJ      :pstS         phosphate ABC transporter
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  252/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->309 1twyE PDBj 1e-08 28.6 %
:RPS:PDB   26->328 2capA PDBj 5e-33 12.2 %
:RPS:SCOP  26->328 2v3qA1  c.94.1.1 * 3e-36 12.5 %
:HMM:SCOP  15->334 1pc3A_ c.94.1.1 * 2e-67 36.9 %
:BLT:SWISS 30->322 SPHX_SYNE7 3e-25 33.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21985.1 GT:GENE pstS GT:PRODUCT phosphate ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1132929..1133945) GB:FROM 1132929 GB:TO 1133945 GB:DIRECTION - GB:GENE pstS GB:PRODUCT phosphate ABC transporter GB:NOTE periplasmic phosphate-binding protein PstS GB:PROTEIN_ID AAZ21985.1 GB:DB_XREF GI:71062982 GB:GENE:GENE pstS LENGTH 338 SQ:AASEQ MKNVKIILSILTVMLFASNVQARDQIRIVGSSTVYPYATVVAENFGKTGKFKTPVIESTGTGGGMKLFCAGVGTDHPDITNASRAIKSKEKALCEKNGVTEIIEIIVGNDGISLAHAVDSPDSNFTKEQLWRALANEVDVDGKLVANPYKQWSDIDPSLPSKKIEILIAPPTSGTRDAWNSLVMSKGCSKEAKALFGDKASSECTKIREDGYAVEAGENDTLIVQKLASNPDAYGFFGYSYLVGNKDKVKAAAIEGVKPSLEGIQDYSYPIARPLFFYVKKAHIGVVPGIDAFIKDFTSKKAMGPRGYLAEIGLVPLAKAKYDVVRTAAVELNTISIK GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 30->322|SPHX_SYNE7|3e-25|33.3|255/337| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 25->309|1twyE|1e-08|28.6|238/242| RP:PDB:NREP 1 RP:PDB:REP 26->328|2capA|5e-33|12.2|287/376| RP:SCP:NREP 1 RP:SCP:REP 26->328|2v3qA1|3e-36|12.5|287/376|c.94.1.1| HM:SCP:REP 15->334|1pc3A_|2e-67|36.9|293/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 310 OP:NHOMOORG 264 OP:PATTERN -----------------------11112--121-2-------------21--1--------------- ---------------------------------------1--------------------111-------------------------------------------1-1----------------121322221-122222---213421332--221---11-115211----------------11----1-111111111111111-1----1111111111--------11111111111111111111----------------------------------------------------------------------2-2---1-1111-1-1----11-1---11--11---1-------1-------1211111111-----------1-11111111111---------1-11111111111111-1-111111111111-------------1121111111111---------------1111111-1---------------------------------------1----------1-3-111---------1121-21-3-1111-1---1------1---------1-1----111111----------1---------11--1-1-------1-------1-----1----------------------------------------------------------------------------------------------------------21-1----------------1111111-------------1----1-------------11111-11-11111----------------1-11----------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 314 STR:RPRED 92.9 SQ:SECSTR #######################cEccEEEccTTHHHHTcTTTccTTccccEEccHHHHTcGGGTcccTTccccccccEEEEcccccHHHHHHHHHHTHccEEEEEEEEEEccccccccccccEEcHHHHHHHHHTccTTccccTTcHHccGGGcTTcccccccEEEEEccccHHHHHHHHHHHHHccccccccccccGGGTcTTccTTcTTcEEEcHHHHHHHHcTTccccEEccccHHHHcccGGGGGcTTTcEEETTEEEccccccccEEEEEEEEEccccHHHHHHHHHHHHHTccccccHHHHHHHTTcccccHHHHHHHHHHHHHHcccTT# DISOP:02AL 337-338| PSIPRED cHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHccccccEEEEEEEEEEEEEEccccccccccHHHHHHHHccccccccHHcccccccccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccHHHHHHHHHcccccEEEEEHHHHHHccccccEEEcccccccHHHHHcccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHHHHccccccc //