[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : qacE
DDBJ      :qacE         Small Multidrug Resistance protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  316/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:110 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->109 1s7bB PDBj 6e-19 39.0 %
:RPS:SCOP  6->103 1s7bA  f.39.1.1 * 1e-07 39.8 %
:HMM:SCOP  6->111 1s7bA_ f.39.1.1 * 1e-13 26.4 %
:RPS:PFM   3->95 PF00893 * Multi_Drug_Res 8e-11 40.9 %
:HMM:PFM   4->95 PF00893 * Multi_Drug_Res 6e-24 39.1 92/93  
:BLT:SWISS 5->103 YVAE_BACSU 2e-19 37.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21444.1 GT:GENE qacE GT:PRODUCT Small Multidrug Resistance protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(611858..612190) GB:FROM 611858 GB:TO 612190 GB:DIRECTION - GB:GENE qacE GB:PRODUCT Small Multidrug Resistance protein GB:PROTEIN_ID AAZ21444.1 GB:DB_XREF GI:71062441 GB:GENE:GENE qacE LENGTH 110 SQ:AASEQ MIKTYLFLTIAIFCEVGGTMLLPVSQNFTKIIPTTTLAILYLSSFYLLTFVVDKLPIAIVYATWSGLGIFTIAILGYIFFKQSLSWQAVLGLFFIVTGVVLVNSFTIKTI GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 5->103|YVAE_BACSU|2e-19|37.4|99/119| TM:NTM 4 TM:REGION 2->24| TM:REGION 32->54| TM:REGION 59->81| TM:REGION 86->108| BL:PDB:NREP 1 BL:PDB:REP 5->109|1s7bB|6e-19|39.0|105/107| RP:PFM:NREP 1 RP:PFM:REP 3->95|PF00893|8e-11|40.9|93/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 4->95|PF00893|6e-24|39.1|92/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| RP:SCP:NREP 1 RP:SCP:REP 6->103|1s7bA|1e-07|39.8|98/106|f.39.1.1| HM:SCP:REP 6->111|1s7bA_|1e-13|26.4|106/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 450 OP:NHOMOORG 321 OP:PATTERN -------------------------------------------------11-1--------------- -1-----------------------------------------------------1-1----1--1----------------1-----------------11----------------------111--1-1121-11111----------------1111-1----111-----------------------2333332322233223-11123312---1--2-----11---------------------1----------22------1------------------------------------------------------1-----------------------1------1--------------1-------------1---11111--11111111111-1---1-------111-1121111111-1-1-11211111222222221-----21-----------------------------2--1--1111111111111111111-1111111111-1------1-2111---------2-11---11--------111-----1-1111-1-----1--1---------------------------------1121-11---111------21-----111-21---2----------1111112222244322-312311213332122222213-322232112232232222224211122222111111111111111---1-------111-1111--11------1-11215--111-1----212-1111-1111-----1-----11------111--221111-111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 95.5 SQ:SECSTR ####cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHHHHHHHHHT# PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc //