[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : qacH
DDBJ      :qacH         multidrug resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  114/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->110 1s7bB PDBj 3e-10 29.8 %
:RPS:SCOP  22->106 1s7bA  f.39.1.1 * 6e-04 34.1 %
:HMM:SCOP  8->109 1s7bA_ f.39.1.1 * 3.9e-11 25.5 %
:RPS:PFM   25->97 PF00893 * Multi_Drug_Res 8e-08 37.0 %
:HMM:PFM   6->97 PF00893 * Multi_Drug_Res 9.6e-18 29.3 92/93  
:BLT:SWISS 6->107 QACF_ENTAE 1e-14 34.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21604.1 GT:GENE qacH GT:PRODUCT multidrug resistance protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(763013..763345) GB:FROM 763013 GB:TO 763345 GB:DIRECTION - GB:GENE qacH GB:PRODUCT multidrug resistance protein GB:NOTE quaternary ammonium compounds GB:PROTEIN_ID AAZ21604.1 GB:DB_XREF GI:71062601 GB:GENE:GENE qacH LENGTH 110 SQ:AASEQ MNMTTSYLFLALAVVLGVASNSFAKSAEGFTLLVPSIITAITIVLCMYALSMVMKNIPMGITYASFAGLAIISTVGVGIIKYNQVPNLYSIVGLCFIIVGVLMVNLLGNN GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 6->107|QACF_ENTAE|1e-14|34.3|102/110| TM:NTM 4 TM:REGION 6->28| TM:REGION 31->53| TM:REGION 61->82| TM:REGION 88->109| SEG 10->19|lalavvlgva| BL:PDB:NREP 1 BL:PDB:REP 7->110|1s7bB|3e-10|29.8|104/107| RP:PFM:NREP 1 RP:PFM:REP 25->97|PF00893|8e-08|37.0|73/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 6->97|PF00893|9.6e-18|29.3|92/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| RP:SCP:NREP 1 RP:SCP:REP 22->106|1s7bA|6e-04|34.1|85/106|f.39.1.1| HM:SCP:REP 8->109|1s7bA_|3.9e-11|25.5|102/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 130 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- ------------1-----------------------------------------------1---------------------------------------1--------------------------------------------------------111-------111-------------------------------------------1-1-----1-------------------------------1------------------1------------------------------------------------------1---------------------------------------------1------------------1--1--11111111112--------------------1111-11-----------1------------------------------------------1-1-3-----------1111-1----111------1----12--------1-11---1-----2--1-------------1-1-------------------------------------------------------1111--1---211------1------1---1---------------1-11-1-----111-----------1---1-----21--11213-----1--1------21-------1-111111111111--------------1--1-------------1-11215------1------------------------------------1----11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 94.5 SQ:SECSTR ######cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-2, 109-110| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccc //