[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : qacH2
DDBJ      :qacH2        Quaternary ammonium compound-resistance protein qacH
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->90 1s7bB PDBj 2e-08 28.6 %
:HMM:SCOP  8->113 1s7bA_ f.39.1.1 * 3.1e-13 25.5 %
:RPS:PFM   7->88 PF00893 * Multi_Drug_Res 3e-06 28.0 %
:HMM:PFM   7->97 PF00893 * Multi_Drug_Res 1.5e-20 29.7 91/93  
:BLT:SWISS 7->84 QACH_STASA 7e-15 38.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21605.1 GT:GENE qacH2 GT:PRODUCT Quaternary ammonium compound-resistance protein qacH GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(763345..763680) GB:FROM 763345 GB:TO 763680 GB:DIRECTION - GB:GENE qacH2 GB:PRODUCT Quaternary ammonium compound-resistance protein qacH GB:PROTEIN_ID AAZ21605.1 GB:DB_XREF GI:71062602 GB:GENE:GENE qacH2 LENGTH 111 SQ:AASEQ MNLTGGYIFLVLAIILGISSNGFLKATDGFTNIYPTIFCIITIVACIFCLSKAMTIIPVGFTYATYGGLTITAVTIFGVVKYNQTPNLYAVLGISLIIIGVILLNTMGKTN GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 7->84|QACH_STASA|7e-15|38.5|78/107| TM:NTM 4 TM:REGION 2->24| TM:REGION 36->58| TM:REGION 62->84| TM:REGION 87->108| SEG 91->104|vlgisliiigvill| BL:PDB:NREP 1 BL:PDB:REP 7->90|1s7bB|2e-08|28.6|84/107| RP:PFM:NREP 1 RP:PFM:REP 7->88|PF00893|3e-06|28.0|82/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 7->97|PF00893|1.5e-20|29.7|91/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| HM:SCP:REP 8->113|1s7bA_|3.1e-13|25.5|106/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 69 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------1---1--1------------------------------------------------------------------------------------1-------------------------------1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------11-1------1-11------------------------------------------------2-----1----11111111111111-111111111-----------------------------------------1-----------------------------------------------------------1-------211------1-------------------------------------11------------1---------111-11112----------------1--------11-----------11------------1-----------------------------1---------------------------111-----------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 75.7 SQ:SECSTR ######cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTcccccccc##################### DISOP:02AL 109-111| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccc //