[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : recO
DDBJ      :recO         Recombination protein O
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:226 amino acids
:PSIPRED
:RPS:SCOP  3->61 1u5kA1  b.40.4.13 * 1e-08 19.0 %
:HMM:SCOP  1->49 1u5kA1 b.40.4.13 * 0.00033 25.0 %
:HMM:PFM   1->67 PF11967 * RecO_N 7.4e-15 21.2 66/80  
:HMM:PFM   86->206 PF02565 * RecO_C 4.5e-14 25.3 99/118  
:BLT:SWISS 1->131 RECO_EHRCR 1e-15 30.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21858.1 GT:GENE recO GT:PRODUCT Recombination protein O GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1022169..1022849) GB:FROM 1022169 GB:TO 1022849 GB:DIRECTION - GB:GENE recO GB:PRODUCT Recombination protein O GB:PROTEIN_ID AAZ21858.1 GB:DB_XREF GI:71062855 GB:GENE:GENE recO LENGTH 226 SQ:AASEQ MNWDDSAYLVSKNRYSENSIIAEVFTENHGKISGIIFGGTSKKIKNYLQIGNKIYVNYNSKSVTRIGYFKIEILKALTPLYFDQNQKLSCITSAMHLIKLLTAEAQSNKEIFKLIDKFFEILNSENWIQKYIFWELELLKLLGYDLELKTMAEKEIVDSEVNYYVKSSTEKKSIPNFLIDENNMDVNLKNLLKGLKLVSDYLEKSILKPNNLNLPTSRTHFINLLK GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 1->131|RECO_EHRCR|1e-15|30.2|129/244| SEG 135->148|elellkllgydlel| SEG 187->197|nlknllkglkl| HM:PFM:NREP 2 HM:PFM:REP 1->67|PF11967|7.4e-15|21.2|66/80|RecO_N| HM:PFM:REP 86->206|PF02565|4.5e-14|25.3|99/118|RecO_C| RP:SCP:NREP 1 RP:SCP:REP 3->61|1u5kA1|1e-08|19.0|58/78|b.40.4.13| HM:SCP:REP 1->49|1u5kA1|0.00033|25.0|48/0|b.40.4.13|1/1|Nucleic acid-binding proteins| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-1-1-----------------------1-11-------11------1-1111111------------------111---11--1-11-1-111111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEEEEEEccccccHHHHHHccccccEEEEEEEccccccccHHcccccEEEEEEEEEccccccEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccEEEEcccccccccccccEEEEcccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHc //