[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : recX
DDBJ      :recX         Regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->169 3c1dB PDBj 3e-12 17.3 %
:RPS:PFM   56->176 PF02631 * RecX 5e-07 27.4 %
:HMM:PFM   55->171 PF02631 * RecX 5.7e-18 23.9 109/122  
:HMM:PFM   21->60 PF08463 * EcoEI_R_C 0.00027 17.5 40/231  
:BLT:SWISS 15->175 RECX_MYXXD 3e-11 27.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21641.1 GT:GENE recX GT:PRODUCT Regulatory protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 796378..796932 GB:FROM 796378 GB:TO 796932 GB:DIRECTION + GB:GENE recX GB:PRODUCT Regulatory protein GB:PROTEIN_ID AAZ21641.1 GB:DB_XREF GI:71062638 GB:GENE:GENE recX LENGTH 184 SQ:AASEQ MRNRKKTLQVTVEEMRNFSFAYIERYAPSKQQLRTYLLKKYLKANLENIKKQDITDLIDVVLQDLEKTKFINDKFYSESKSRSLIQRGSSVNKIRNYLMTKGINDRYIKETIDKIKEDNSDQDFFSGIKICKKKRIGPARVEDNRALFYKKDIALLARNGFDFETSKRIMDIDKADYMKIIRLL GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 15->175|RECX_MYXXD|3e-11|27.1|155/187| RP:PDB:NREP 1 RP:PDB:REP 12->169|3c1dB|3e-12|17.3|150/154| RP:PFM:NREP 1 RP:PFM:REP 56->176|PF02631|5e-07|27.4|113/123|RecX| HM:PFM:NREP 2 HM:PFM:REP 55->171|PF02631|5.7e-18|23.9|109/122|RecX| HM:PFM:REP 21->60|PF08463|0.00027|17.5|40/231|EcoEI_R_C| GO:PFM:NREP 1 GO:PFM GO:0006282|"GO:regulation of DNA repair"|PF02631|IPR003783| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-----------------------------1--------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 87.5 SQ:SECSTR ##########HHHHHHHHHHHHHTTccccHHHHHHHHcccEEETTEEEccccccHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHTTccHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHTTccHHHHTTcTH############# DISOP:02AL 1-11| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHc //