[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : regB
DDBJ      :regB         Sensor histidine kinase (two component sensor)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:426 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   181->369 3crkB PDBj 9e-11 8.0 %
:RPS:SCOP  278->369 1bxdA  d.122.1.3 * 7e-07 13.3 %
:HMM:SCOP  287->422 1ysrA1 d.122.1.3 * 1.9e-15 24.2 %
:RPS:PFM   320->369 PF02518 * HATPase_c 9e-05 36.0 %
:HMM:PFM   316->417 PF02518 * HATPase_c 2.8e-14 25.0 100/111  
:HMM:PFM   205->261 PF00512 * HisKA 4.3e-05 28.6 56/68  
:HMM:PFM   122->195 PF08510 * PIG-P 0.00037 23.9 71/126  
:BLT:SWISS 16->424 REGB_RHOS4 2e-25 25.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21269.1 GT:GENE regB GT:PRODUCT Sensor histidine kinase (two component sensor) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 443294..444574 GB:FROM 443294 GB:TO 444574 GB:DIRECTION + GB:GENE regB GB:PRODUCT Sensor histidine kinase (two component sensor) GB:PROTEIN_ID AAZ21269.1 GB:DB_XREF GI:71062266 GB:GENE:GENE regB LENGTH 426 SQ:AASEQ MKFFETSKYFSLKKSTYINLRWIAIIGQLITVNVIYFFFDFRFNLILENSIILIGALSNLYLIYINKNTQLSDKTAFLFLSIDILQLSCLIYLTGGIINPFSIFLIIPAIFSSSNLGFRSNLLLVSLTVLVIIFLTFFNQPLPYPIKEHFHVDSYYYYSIPIALIIALIFLNYFALTFGSESRIRKEALNKMEEIMSKEHELLSLGGQAAAAAHSLGTPFSTMKIISTDLLERFKDNEDVKKDIELLSSQLERCSEILKKLTLNPIIEDNFIDRDLTMAEYVSEIVKSFQEVSKKDFIVNYDQNSNPLNITKSIEIIYGLRNFIGNANKFSENKIFINIKSDSDFTEVMIEDDGEGYPKDVLSKIGEPYIKSFKSSIKSKSGLGLGIFIGKTLLEKNYANILCRNSQTRSGAEVSIKWKNEDLLKL GT:EXON 1|1-426:0| BL:SWS:NREP 1 BL:SWS:REP 16->424|REGB_RHOS4|2e-25|25.6|407/462| TM:NTM 5 TM:REGION 18->40| TM:REGION 45->67| TM:REGION 83->105| TM:REGION 120->142| TM:REGION 159->179| SEG 122->136|lllvsltvlviiflt| SEG 154->176|syyyysipialiialiflnyfal| SEG 209->213|aaaaa| SEG 370->387|iksfkssiksksglglgi| RP:PDB:NREP 1 RP:PDB:REP 181->369|3crkB|9e-11|8.0|187/370| RP:PFM:NREP 1 RP:PFM:REP 320->369|PF02518|9e-05|36.0|50/112|HATPase_c| HM:PFM:NREP 3 HM:PFM:REP 316->417|PF02518|2.8e-14|25.0|100/111|HATPase_c| HM:PFM:REP 205->261|PF00512|4.3e-05|28.6|56/68|HisKA| HM:PFM:REP 122->195|PF08510|0.00037|23.9|71/126|PIG-P| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 278->369|1bxdA|7e-07|13.3|90/161|d.122.1.3| HM:SCP:REP 287->422|1ysrA1|1.9e-15|24.2|132/0|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 81 OP:NHOMOORG 78 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111121111122111111111111-11111111111-111111111111111111111111-11--------------1------------------------------1---------------------------------------------111-------1---11------------------------------------------------------------------------11-----1--------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 56.1 SQ:SECSTR ###################################################################################################################################################################################HHHHTTccccTTcHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHTTTcccccEEEEEEEcccTTcccEEEEcHHHHHHHHHHHHHHHHHHHHHTcccccEEcccEEEEEEEEccccccHHHHGGGGcTTcccccTTTcTTcccccHHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEE######## DISOP:02AL 1-2, 193-203, 233-237, 373-382| PSIPRED ccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccEEEEEEcccccEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccEEEEEEEEccccccHHHHHHcccccEEcccccccccccccHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEEcHHHcccc //