[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : rfaD
DDBJ      :rfaD         ADP-L-glycero-D-mannoheptose-6-epimerase
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  250/915 : Eukaryota  38/199 : Viruses  1/175   --->[See Alignment]
c.2.1
:292 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->271 1eq2B PDBj 3e-15 26.3 %
:RPS:PDB   5->277 1db3A PDBj 9e-14 14.9 %
:RPS:SCOP  5->249 1sb8A  c.2.1.2 * 1e-26 25.1 %
:HMM:SCOP  2->294 2b69A1 c.2.1.2 * 1.3e-41 29.4 %
:RPS:PFM   5->221 PF01370 * Epimerase 6e-11 28.1 %
:HMM:PFM   5->230 PF01370 * Epimerase 1.6e-34 27.3 220/238  
:BLT:SWISS 4->277 GALE_METJA 5e-17 27.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21393.1 GT:GENE rfaD GT:PRODUCT ADP-L-glycero-D-mannoheptose-6-epimerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 563601..564479 GB:FROM 563601 GB:TO 564479 GB:DIRECTION + GB:GENE rfaD GB:PRODUCT ADP-L-glycero-D-mannoheptose-6-epimerase GB:PROTEIN_ID AAZ21393.1 GB:DB_XREF GI:71062390 GB:GENE:GENE rfaD LENGTH 292 SQ:AASEQ MKNLIIVTGGAGFVGSNLIELLLKKTKYKILSIDNYSSGLKKNHIKNKRLKYIKGHTKNITKLLASKKKKIKVIFHFGEFARIYQSFLKMNECIDANSVGSNEVFNFCFLNKIKLIYSATSASIGNNGEDKNLSPYAFTKSKNLELLENLKKWFGFKFEIIYFYNVYGPNQIENGEMATVIGIFENQYNNNKYLTVVKPGSQTRRFTHIKDTVDACYLAFKRNKNRHYSISHKKSYSILEVAKMFTHKIKFIPARPGERFASALTNMNLSNKVYKLYGKINLKNYIKSLKNK GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 4->277|GALE_METJA|5e-17|27.2|261/305| SEG 58->72|knitkllaskkkkik| SEG 140->152|ksknlellenlkk| BL:PDB:NREP 1 BL:PDB:REP 4->271|1eq2B|3e-15|26.3|259/299| RP:PDB:NREP 1 RP:PDB:REP 5->277|1db3A|9e-14|14.9|261/335| RP:PFM:NREP 1 RP:PFM:REP 5->221|PF01370|6e-11|28.1|210/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 5->230|PF01370|1.6e-34|27.3|220/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 5->249|1sb8A|1e-26|25.1|243/341|c.2.1.2| HM:SCP:REP 2->294|2b69A1|1.3e-41|29.4|286/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 370 OP:NHOMOORG 324 OP:PATTERN --1--------------211111-2-------12122-1111211132--122-1111111---2--1 111----2111------11-1---1-11111----------------------------------------------------11221-----------11111--11-------------------------------1---1------11-------------------1--211-1-1-1-------1---111111-111111-11311-11111--11---------11-------------------2------1----21111-1----1----------------------------------------------11-2-1111221-1-1-11------1---------1-12111----212--21-----------1---------1-----------------------------------1----------------------------1-1-----------------------------1-----2-------1--1--------------1-------1---------------------1----1-----11---1--------1---1------1------11-11--------------------1----------------------1-----1--2--1----1--------11-111-1111111111-1111111111111111111111111111111111111111111-11111111-1111111111111---22222---------------1-------1------1--11----1111--111------111111111------------------------------11--1111------------------------------------1111-1-111--1 ----1------1-2------------1-----------------------------------------------------------------------------------------2-1---1111-1-111-111----1--11-1---1--1-111----1----------1-----5221---------111322- -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 100.0 SQ:SECSTR cEEEEEEETTTcHHHHHHHHHHHHTTcEEEEEccccEEEcccccccHHHHHHHHHHHcccEcEEEEEEEcTTcEEEcccccTTTTTTccHHHHHHHHTHHHHHHHHHHHHTTcTTTcEEEEEEEGGGGTTccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEcTTccTTcHHHHHHHHHHHHHTTccccEEEccTTcEEccEEHHHHHHHHHHTTcccccccEEEcccccEEHHHHHHHEEEEEEccGGGcEEEEEEEcccccTTccTTcEETcccHHHHHHHHHHT PSIPRED cccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHccccccEEEEEcccccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHcccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHHHHHHHHccccEEEEccccccEEHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHcccccccHHHHHHHHHcc //