[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : rhtB
DDBJ      :rhtB         LysE type translocator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->172 PF01810 * LysE 1e-09 25.5 %
:HMM:PFM   14->196 PF01810 * LysE 2.4e-23 22.0 182/192  
:BLT:SWISS 19->177 RHTB_SHIFL 4e-07 22.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22165.1 GT:GENE rhtB GT:PRODUCT LysE type translocator GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1297008..1297622) GB:FROM 1297008 GB:TO 1297622 GB:DIRECTION - GB:GENE rhtB GB:PRODUCT LysE type translocator GB:NOTE possible threonine efflux pump GB:PROTEIN_ID AAZ22165.1 GB:DB_XREF GI:71063162 GB:GENE:GENE rhtB LENGTH 204 SQ:AASEQ MLPLNYFLFLQIILFLFITPGTPRIVIISYSMNYGVQKCIWTALGDVTANIIQATLVIFVLGSFFVDNPNFLNTFKWIGIAYLLYLAYDIYNSRPKDINSNNISSKSFFSFFKDGFLVAGTSPKAWMFFPLIFPQFIDFNSNYIVQFIILITTYAVLDFLSLIAYAVLARKLIVWIKANPKVINTISACVLILIALIIAFIQNY GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 19->177|RHTB_SHIFL|4e-07|22.0|159/206| TM:NTM 5 TM:REGION 9->31| TM:REGION 42->64| TM:REGION 115->137| TM:REGION 148->169| TM:REGION 180->201| SEG 7->18|flflqiilflfi| SEG 81->88|ayllylay| SEG 96->114|kdinsnnissksffsffkd| SEG 186->201|isacvlilialiiafi| RP:PFM:NREP 1 RP:PFM:REP 19->172|PF01810|1e-09|25.5|153/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 14->196|PF01810|2.4e-23|22.0|182/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 24 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------11----------------------------------------------------1-------------------------------1--------------------------------------------------------------------------------1--------------------------1---1-------------1-1-111--------------------1----------------------------------1--------------------------------------------------------1-1---------------------------------11--1-------------------2----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 91-110| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //